Advanced Search (OLGA)

Gene: Sumo2 (small ubiquitin-like modifier 2) Rattus norvegicus

Analyze

Symbol:

Sumo2

Name:

small ubiquitin-like modifier 2

RGD ID:

621761

Description:

Enables nuclear retinoid X receptor binding activity. Involved in several processes, including negative regulation of DNA-templated transcription; positive regulation of protein sumoylation; and protein sumoylation. Predicted to be located in PML body. Predicted to be active in several cellular components, including hippocampal mossy fiber to CA3 synapse; postsynaptic cytosol; and presynaptic cytosol. Orthologous to human SUMO2 (small ubiquitin like modifier 2); PARTICIPATES IN RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC690244; MGC72702; MGC93211; sentrin-2; similar to SMT3 suppressor of mif two 3 homolog 2; small ubiquitin-related modifier 2; SMT3 homolog 2; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 2 (yeast); Smt3A; Smt3h2; SUMO-2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SUMO2 (small ubiquitin like modifier 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Sumo2 (small ubiquitin-like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sumo2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SUMO2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SUMO2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sumo2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SUMO2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SUMO2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sumo2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sumo2 (small ubiquitin like modifier 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SUMO3 (small ubiquitin like modifier 3)	HGNC	OrthoDB, Panther, Treefam
Homo sapiens (human):	SUMO4 (small ubiquitin like modifier 4)	HGNC	OrthoDB, Panther, Treefam
Homo sapiens (human):	JPT1 (Jupiter microtubule associated homolog 1)	HGNC	Ensembl, OrthoDB
Homo sapiens (human):	CLDN16 (claudin 16)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Sumo2 (small ubiquitin-like modifier 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SUMO2 (small ubiquitin like modifier 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SUMO2 (small ubiquitin like modifier 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sumo2b (small ubiquitin-like modifier 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sumo2b (small ubiquitin-like modifier 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SMT3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SMT3	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	smt3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sumo2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sumo2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)

Related Pseudogenes:

Sumo4

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,270,899 - 101,283,458 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	101,270,900 - 101,283,938 (-)	Ensembl				GRCr8
GRCr8 Ensembl	5	124,963,085 - 124,963,445 (-)	Ensembl				GRCr8
mRatBN7.2	10	100,771,941 - 100,784,503 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,686,797 - 100,784,513 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	5	15,099,419 - 15,099,706 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	105,831,894 - 105,844,470 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,294,964 - 105,307,540 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,692,910 - 100,705,469 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,085,401 - 104,097,983 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,086,002 - 104,097,812 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	104,184,388 - 104,195,497 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	105,608,097 - 105,620,455 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	99,346,621 - 99,359,172 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,6-dimethoxyphenol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

cadmium dichloride (EXP,ISO)

cantharidin (ISO)

CB-5083 (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chrysene (ISO)

copper atom (ISO)

copper(0) (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

disulfiram (ISO)

elemental selenium (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

glyphosate (ISO)

hinokiflavone (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

methidathion (ISO)

methimazole (EXP)

N-ethylmaleimide (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

nimesulide (EXP)

nitrates (ISO)

okadaic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tungsten (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular protein localization (IDA)

negative regulation of DNA-templated transcription (IMP)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO)

positive regulation of protein sumoylation (IDA)

positive regulation of transcription by RNA polymerase II (ISO)

protein sumoylation (IBA,IDA,IEA,ISO)

Cellular Component

cytoplasm (IEA)

GABA-ergic synapse (ISO)

glutamatergic synapse (ISO)

hippocampal mossy fiber to CA3 synapse (ISO)

nuclear body (ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

PML body (IEA,ISO,ISS)

postsynapse (ISO)

postsynaptic cytosol (ISO)

presynapse (ISO)

presynaptic cytosol (ISO)

Molecular Function

nuclear retinoid X receptor binding (IDA)

protein binding (IPI,ISO)

protein tag activity (IBA)

SUMO transferase activity (ISO)

ubiquitin protein ligase binding (ISO,ISS)

ubiquitin-like protein ligase binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA transport pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The cDNA cloning and molecular evolution of reptile and pigeon lactate dehydrogenase isozymes.	Mannen H, etal., Mol Biol Evol 1997 Nov;14(11):1081-7.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Gene expression and cell growth are modified by silencing SUMO2 and SUMO3 expression.	Yang W and Paschen W, Biochem Biophys Res Commun. 2009 Apr 24;382(1):215-8. doi: 10.1016/j.bbrc.2009.03.013. Epub 2009 Mar 9.
11.	Small ubiquitin-like modifier-2 modification of retinoic acid receptor-alpha regulates its subcellular localization and transcriptional activity.	Zhu L, etal., Endocrinology. 2009 Dec;150(12):5586-95. doi: 10.1210/en.2009-0868. Epub 2009 Oct 22.

Additional References at PubMed

PMID:15277470	PMID:15489334	PMID:15767674	PMID:17081986	PMID:17696781	PMID:18167501	PMID:18408734	PMID:18644859	PMID:20075418	PMID:21330375	PMID:21518833	PMID:21931855
PMID:21965678	PMID:22406621	PMID:22681889	PMID:22891650	PMID:24105744	PMID:24971350	PMID:37403456

Genomics

Comparative Map Data

Sumo2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	101,270,899 - 101,283,458 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	101,270,900 - 101,283,938 (-)	Ensembl				GRCr8
GRCr8 Ensembl	5	124,963,085 - 124,963,445 (-)	Ensembl				GRCr8
mRatBN7.2	10	100,771,941 - 100,784,503 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	100,686,797 - 100,784,513 (-)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	5	15,099,419 - 15,099,706 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	105,831,894 - 105,844,470 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	105,294,964 - 105,307,540 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	100,692,910 - 100,705,469 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	104,085,401 - 104,097,983 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	104,086,002 - 104,097,812 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	104,184,388 - 104,195,497 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	105,608,097 - 105,620,455 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	99,346,621 - 99,359,172 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

SUMO2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	75,165,586 - 75,182,959 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	75,165,586 - 75,182,991 (-)	Ensembl			hg38	GRCh38
GRCh37	17	73,161,681 - 73,179,054 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	70,675,420 - 70,690,693 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	70,675,419 - 70,690,693	NCBI
Celera	17	69,756,196 - 69,771,477 (-)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	68,573,023 - 68,588,319 (-)	NCBI		HuRef
CHM1_1	17	73,228,330 - 73,243,802 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	76,057,065 - 76,074,452 (-)	NCBI		T2T-CHM13v2.0

Sumo2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	115,413,935 - 115,427,056 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	115,413,928 - 115,427,102 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	115,523,109 - 115,536,230 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	115,523,102 - 115,536,276 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	115,384,423 - 115,397,544 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	116,412,880 - 116,426,015 (-)	NCBI		MGSCv36	mm8
MGSCv36	11	115,339,199 - 115,352,320 (-)	NCBI		MGSCv36	mm8
Celera	11	127,289,555 - 127,301,144 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	80.84	NCBI

Sumo2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955553	2,045,415 - 2,065,863 (-)	Ensembl
ChiLan1.0	NW_004955553	2,045,277 - 2,066,023 (-)	NCBI	ChiLan1.0	ChiLan1.0

SUMO2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	91,207,894 - 91,222,668 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	96,030,950 - 96,045,638 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	69,115,433 - 69,130,065 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	74,676,897 - 74,683,990 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

SUMO2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	5,298,315 - 5,311,184 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	5,298,340 - 5,311,184 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	5,977,248 - 5,990,106 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	5,968,618 - 5,981,517 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	5,968,617 - 5,981,522 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	6,007,031 - 6,019,893 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	6,117,312 - 6,130,163 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	6,177,319 - 6,190,161 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sumo2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	5,925,294 - 5,942,343 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	469,354 - 486,665 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	469,616 - 484,375 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUMO2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	6,116,606 - 6,130,350 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	6,116,694 - 6,130,089 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	6,079,142 - 6,092,538 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUMO2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	46,479,399 - 46,495,591 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	46,479,406 - 46,496,114 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	17,253,281 - 17,269,592 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sumo2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624801	4,998,271 - 5,009,492 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sumo2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	68,557,765 - 68,570,307 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sumo2
29 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000004867
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	81012077	101828297	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC058446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF976332	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L79949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004862 ⟹ ENSRNOP00000004862

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,243,430 - 101,261,469 (-)	Ensembl
mRatBN7.2 Ensembl	10	100,744,467 - 100,762,518 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000004867 ⟹ ENSRNOP00000004867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,271,500 - 101,283,458 (-)	Ensembl
mRatBN7.2 Ensembl	10	100,772,542 - 100,784,513 (-)	Ensembl
Rnor_6.0 Ensembl	10	104,086,002 - 104,097,812 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000049609 ⟹ ENSRNOP00000044856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,763,800 - 100,784,474 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100244 ⟹ ENSRNOP00000084127

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	124,963,085 - 124,963,445 (-)	Ensembl
mRatBN7.2 Ensembl	5	15,099,419 - 15,099,706 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115704 ⟹ ENSRNOP00000093600

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,270,900 - 101,283,938 (-)	Ensembl
mRatBN7.2 Ensembl	10	100,763,800 - 100,783,888 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119507 ⟹ ENSRNOP00000096769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	100,686,797 - 100,784,490 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000141340 ⟹ ENSRNOP00000099851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,243,424 - 101,261,469 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172405 ⟹ ENSRNOP00000109058

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	101,244,220 - 101,261,469 (-)	Ensembl

RefSeq Acc Id:

NM_133594 ⟹ NP_598278

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	101,270,899 - 101,283,458 (-)	NCBI
mRatBN7.2	10	100,771,941 - 100,784,503 (-)	NCBI
Rnor_6.0	10	104,085,401 - 104,097,983 (-)	NCBI
Rnor_5.0	10	104,184,388 - 104,195,497 (+)	NCBI
RGSC_v3.4	10	105,608,097 - 105,620,455 (-)	RGD
Celera	10	99,346,621 - 99,359,172 (-)	RGD

Sequence:

show sequence

AGGGCGGGGGGAGGGAGCGCACGACGTGCGCGCGCCCTCTGCCTCGTCCACCGCTGCCGCCTCC
TTCTTCTGCCGCTCCTGGTGCTGCTTGTGTGCTCCTTCAGTGCGGACCTGGTGCCTCTTTTGTG
AAGCGGCAGCTGAGGAGACTCCGGCGCTCGCCATGGCCGACGAGAAACCCAAGGAAGGAGTCAA
GACTGAGAACAACGATCATATTAATTTGAAGGTGGCGGGACAGGATGGTTCTGTGGTGCAGTTT
AAGATTAAGAGGCATACACCACTTAGTAAACTAATGAAAGCCTATTGTGAACGGCAGGGTTTGT
CAATGAGGCAGATCAGATTCCGGTTTGATGGGCAACCAATCAACGAAACAGACACACCTGCACA
GTTGGAAATGGAGGATGAAGATACGATTGATGTGTTCCAGCAGCAGACAGGAGGCGTCTACTGA
AAAGGGAACCTGCTACTTTACTCCAGAATTTTGTTATAGACCAAGAATACATTCTCAATTAGAA
AGCCGCAATTTGGTCCCGCCACATCCTGACTACTGCAGTATAGTTTCTCTCCTCTTTCATTTCC
CTGTCCTCATTTCTTTATTGTACATAAGTAACTGGTGTGTGTGCACAAGCATATTGCTCTTTTT
TTCTTTTCCTTTTTTAAACTAAATGGCCGATGTTCTGTTTTGGTTACATCAGATGGAGACAGTC
TGGGGACAGTTCTGGTTCTGTGACAATATCCCCCTTCTCCACTAGTGGCATGCTCAGTCAGCTC
CTATCTCTCTATCCAGTAAGTTATTTTGCTCTCATTGTTTTAACAAAAGAATCCAACAACACAA
AATCCTCGCATACCTTGTTCGATTGGAGAATTTTAATGTTTTTCATTTATCATTGTAAAACCAA
GGACAATTTTATAACTTTTTTGTACGTAGCTGTTACATGTAGGGCAATCTGTCTTTAAGTAGGG
ATAAATTACTCTTGAACAAAATGATCCTAGATAGTTTTCCCTTCAAGTCAAGCGTCTTGTTGTT
TAAATAAACTTCTTGTTTAAAATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_598278	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58446	(Get FASTA)	NCBI Sequence Viewer
	AAH78746	(Get FASTA)	NCBI Sequence Viewer
	AAL40175	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000044856.3
GenBank Protein	P61959	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_598278 ⟸ NM_133594
- UniProtKB:	P61959 (UniProtKB/Swiss-Prot), F1LN30 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDG QPINETDTPAQLEMEDEDTIDVFQQQTGGVY hide sequence

Ensembl Acc Id:

ENSRNOP00000004867 ⟸ ENSRNOT00000004867

Ensembl Acc Id:

ENSRNOP00000093600 ⟸ ENSRNOT00000115704

Ensembl Acc Id:

ENSRNOP00000004862 ⟸ ENSRNOT00000004862

Ensembl Acc Id:

ENSRNOP00000096769 ⟸ ENSRNOT00000119507

Ensembl Acc Id:

ENSRNOP00000044856 ⟸ ENSRNOT00000049609

Ensembl Acc Id:

ENSRNOP00000084127 ⟸ ENSRNOT00000100244

Ensembl Acc Id:

ENSRNOP00000099851 ⟸ ENSRNOT00000141340

Ensembl Acc Id:

ENSRNOP00000109058 ⟸ ENSRNOT00000172405

Protein Domains

Rad60/SUMO-like Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P61959-F1-model_v2	AlphaFold	P61959	1-95	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621761	AgrOrtholog
BioCyc Gene	G2FUF-22671	BioCyc
Ensembl Genes	ENSRNOG00000003661	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000003670	Ensembl
	ENSRNOG00000069967	Ensembl
	ENSRNOG00000071259	Ensembl
Ensembl Transcript	ENSRNOT00000049609.5	UniProtKB/Swiss-Prot
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921523	IMAGE-MGC_LOAD
	IMAGE:7125132	IMAGE-MGC_LOAD
InterPro	Rad60/SUMO-like_dom	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Ubiquitin_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:690244	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72702	IMAGE-MGC_LOAD
	MGC:93211	IMAGE-MGC_LOAD
NCBI Gene	Sumo2	ENTREZGENE
PANTHER	SMALL UBIQUITIN-RELATED MODIFIER	UniProtKB/Swiss-Prot
Pfam	Rad60-SLD	UniProtKB/Swiss-Prot
PhenoGen	Sumo2	PhenoGen
PROSITE	UBIQUITIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003661	RatGTEx
	ENSRNOG00000003670	RatGTEx
	ENSRNOG00000069967	RatGTEx
	ENSRNOG00000071259	RatGTEx
SMART	UBQ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I6A1B7_RAT	UniProtKB/TrEMBL
	A0A8I6AX97_RAT	UniProtKB/TrEMBL
	A0ABK0L5H0_RAT	UniProtKB/TrEMBL
	A0ABK0LSQ2_RAT	UniProtKB/TrEMBL
	F1LN30	ENTREZGENE
	F1M2K3_RAT	UniProtKB/TrEMBL
	P61959	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P55855	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-07-12	Sumo2	small ubiquitin-like modifier 2	Sumo2	SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-20	Sumo2	SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)	Sumo2	SMT3 suppressor of mif two 3 homolog 2 (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-08	Sumo2	SMT3 suppressor of mif two 3 homolog 2 (yeast)	LOC690244	similar to SMT3 suppressor of mif two 3 homolog 2	Data merged from RGD:1582866	737654	APPROVED
2006-11-19	LOC690244	similar to SMT3 suppressor of mif two 3 homolog 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Sumo2	SMT3 suppressor of mif two 3 homolog 2 (yeast)	Smt3h2		Symbol updated	1299863	APPROVED
2002-08-07	Smt3h2	SMT3 suppressor of mif two 3 homolog 2 (yeast)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	present in the muscle and heart of alligator and turtle and in the testis of pigeon	634201

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)