Advanced Search (OLGA)

Gene: Foxc2 (forkhead box C2) Rattus norvegicus

Analyze

Symbol:

Foxc2

Name:

forkhead box C2

RGD ID:

621703

Description:

Enables DNA binding activity. Predicted to be involved in several processes, including insulin receptor signaling pathway; negative regulation of cold-induced thermogenesis; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including cell surface receptor signaling pathway; circulatory system development; and kidney development. Predicted to be located in nucleus. Human ortholog(s) of this gene implicated in several diseases, including lymphedema; lymphedema-distichiasis syndrome; obesity; ptosis; and type 2 diabetes mellitus. Orthologous to human FOXC2 (forkhead box C2); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BF-3; brain factor 3; Fkh14; Fkhl14; forkhead box C2 (MFH-1 mesenchyme forkhead 1); forkhead box C2 (MFH-1, mesenchyme forkhead 1); forkhead box protein C2; HFH-BF-3; Hfhbf3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXC2 (forkhead box C2)	RGD	RGD
Mus musculus (house mouse):	Foxc2 (forkhead box C2)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxc2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxc2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Foxc2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FOXC2 (forkhead box C2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Foxc2 (forkhead box C2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	FKH1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	croc	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	croc	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fkh-8	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	foxc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	foxc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	66,094,718 - 66,097,420 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	66,094,700 - 66,153,977 (+)	Ensembl				GRCr8
mRatBN7.2	19	49,186,034 - 49,188,736 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	49,185,662 - 49,188,737 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	55,977,317 - 55,980,018 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	56,661,030 - 56,663,732 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	58,875,485 - 58,878,187 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	53,044,379 - 53,047,081 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	53,044,379 - 53,047,081 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	63,788,037 - 63,790,739 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	19	48,432,333 - 48,435,035 (+)	NCBI		Celera
RGSC_v3.1	1	228,513,040 - 228,513,088 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiovascular Abnormalities (ISO)

congenital diaphragmatic hernia (ISO)

congestive heart failure (ISO)

Craniofacial Abnormalities (ISO)

eyelid disease (ISO)

genetic disease (ISO)

Hydrops Fetalis (ISO)

Insulin Resistance (ISO)

lymphedema (ISO)

lymphedema-distichiasis syndrome (ISO)

Lymphedema-Distichiasis Syndrome with Renal Disease and Diabetes Mellitus (ISO)

Musculoskeletal Abnormalities (ISO)

nephritis (ISO)

obesity (ISO)

ptosis (ISO)

tetralogy of Fallot (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

abacavir (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

aldrin (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

cannabidiol (ISO)

CHIR 99021 (ISO)

choline (ISO)

chromium(6+) (ISO)

cocaine (EXP)

copper(II) chloride (ISO)

dabigatran (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (EXP)

diallyl disulfide (ISO)

dimethylselenide (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Doxylamine succinate (ISO)

endosulfan (EXP)

ethylene glycol (ISO)

folic acid (ISO)

genistein (ISO)

glyphosate (EXP)

hydrazines (ISO)

hydroxyl (ISO)

isotretinoin (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

N-nitrosodiethylamine (EXP)

nickel sulfate (ISO)

nilotinib (ISO)

nitrofen (EXP)

ozone (ISO)

panobinostat (ISO)

perfluorooctanoic acid (EXP)

phenethyl caffeate (EXP)

phenylmercury acetate (ISO)

phenytoin (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

artery morphogenesis (ISO)

blood vessel development (ISO)

blood vessel diameter maintenance (ISO)

blood vessel remodeling (ISO)

branching involved in blood vessel morphogenesis (ISO)

camera-type eye development (ISO)

cardiac muscle cell proliferation (ISO)

cell differentiation (IBA)

cell population proliferation (ISO)

collagen fibril organization (ISO)

DNA-templated transcription (IEA)

embryonic cranial skeleton morphogenesis (ISO)

embryonic heart tube development (ISO)

embryonic skeletal system morphogenesis (ISO)

embryonic viscerocranium morphogenesis (ISO)

glomerular endothelium development (ISO)

glomerular mesangial cell development (ISO)

heart development (ISO)

heart morphogenesis (ISO)

insulin receptor signaling pathway (ISO)

kidney development (ISO)

lymph vessel development (ISO)

lymphangiogenesis (ISO)

metanephros development (ISO)

negative regulation of apoptotic process involved in outflow tract morphogenesis (ISO)

negative regulation of cold-induced thermogenesis (ISO,ISS)

negative regulation of transcription by RNA polymerase II (ISO)

neural crest cell development (ISO)

Notch signaling pathway (ISO)

ossification (ISO)

paraxial mesoderm formation (ISO)

paraxial mesodermal cell fate commitment (ISO)

podocyte differentiation (ISO)

positive regulation of cell adhesion mediated by integrin (ISO)

positive regulation of cell migration involved in sprouting angiogenesis (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of endothelial cell migration (ISO)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

positive regulation of vascular wound healing (ISO)

regulation of DNA-templated transcription (IEA,TAS)

regulation of organ growth (ISO)

regulation of transcription by RNA polymerase II (IBA)

response to hormone (ISO)

skeletal system development (ISO)

somitogenesis (ISO)

ureteric bud development (ISO)

vascular endothelial growth factor receptor signaling pathway (ISO)

ventricular cardiac muscle tissue morphogenesis (ISO)

Cellular Component

nuclear body (ISO)

nucleoplasm (ISO)

nucleus (IEA,ISO)

Molecular Function

chromatin DNA binding (ISO)

DNA binding (IDA,IEA,ISO)

DNA-binding transcription activator activity (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (IEA,ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO)

identical protein binding (ISO)

promoter-specific chromatin binding (ISO,ISS)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The FOXC2 C-512T polymorphism is associated with obesity and dyslipidemia.	Carlsson E, etal., Obes Res. 2004 Nov;12(11):1738-43.
2.	FOXC2 is a winged helix gene that counteracts obesity, hypertriglyceridemia, and diet-induced insulin resistance.	Cederberg A, etal., Cell. 2001 Sep 7;106(5):563-73.
3.	Identification of nine tissue-specific transcription factors of the hepatocyte nuclear factor 3/forkhead DNA-binding-domain family.	Clevidence DE, etal., Proc Natl Acad Sci U S A 1993 May 1;90(9):3948-52.
4.	Truncating mutations in FOXC2 cause multiple lymphedema syndromes.	Finegold DN, etal., Hum Mol Genet. 2001 May 15;10(11):1185-9.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Transcriptional genomics associates FOX transcription factors with human heart failure.	Hannenhalli S, etal., Circulation. 2006 Sep 19;114(12):1269-76. Epub 2006 Sep 4.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Systematic search for single nucleotide polymorphisms in the FOXC2 gene: the absence of evidence for the association of three frequent single nucleotide polymorphisms and four common haplotypes with Japanese type 2 diabetes.	Osawa H, etal., Diabetes. 2003 Feb;52(2):562-7.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	FOXC2 mRNA Expression and a 5' untranslated region polymorphism of the gene are associated with insulin resistance.	Ridderstrale M, etal., Diabetes. 2002 Dec;51(12):3554-60.
14.	A novel frameshift mutation of FOXC2 gene in a family with hereditary lymphedema-distichiasis syndrome associated with renal disease and diabetes mellitus.	Yildirim-Toruner C, etal., Am J Med Genet A. 2004 Dec 15;131(3):281-6.

Additional References at PubMed

PMID:8325367	PMID:9106663	PMID:9169153	PMID:9409679	PMID:10364424	PMID:10479458	PMID:10704385	PMID:10767326	PMID:11562355	PMID:11943768	PMID:12114478	PMID:15664398
PMID:16081467	PMID:16456100	PMID:16498405	PMID:16678147	PMID:16839542	PMID:18187037	PMID:18579532	PMID:19170063	PMID:20956529	PMID:21457232	PMID:25609649	PMID:26824865
PMID:33423166	PMID:34739190

Genomics

Comparative Map Data

Foxc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	66,094,718 - 66,097,420 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	66,094,700 - 66,153,977 (+)	Ensembl				GRCr8
mRatBN7.2	19	49,186,034 - 49,188,736 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	49,185,662 - 49,188,737 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	55,977,317 - 55,980,018 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	56,661,030 - 56,663,732 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	58,875,485 - 58,878,187 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	53,044,379 - 53,047,081 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	53,044,379 - 53,047,081 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	63,788,037 - 63,790,739 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	19	48,432,333 - 48,435,035 (+)	NCBI		Celera
RGSC_v3.1	1	228,513,040 - 228,513,088 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

FOXC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	86,566,829 - 86,569,728 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	86,566,829 - 86,569,728 (+)	Ensembl			hg38	GRCh38
GRCh37	16	86,600,435 - 86,603,334 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	85,158,443 - 85,159,948 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	85,158,442 - 85,159,948	NCBI
Celera	16	70,901,820 - 70,903,503 (+)	NCBI		Celera
Cytogenetic Map	16	q24.1	NCBI
HuRef	16	72,340,749 - 72,342,345 (+)	NCBI		HuRef
CHM1_1	16	88,012,585 - 88,014,267 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	92,635,146 - 92,638,044 (+)	NCBI		T2T-CHM13v2.0

Foxc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	121,842,910 - 121,845,634 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	121,842,910 - 121,845,634 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	121,116,171 - 121,118,895 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	121,116,171 - 121,118,895 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	123,640,071 - 123,642,795 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	124,002,560 - 124,004,872 (+)	NCBI		MGSCv36	mm8
Celera	8	125,334,251 - 125,336,975 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	70.33	NCBI

FOXC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	96,322,973 - 96,325,904 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	102,240,170 - 102,243,107 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	67,237,476 - 67,239,545 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	86,569,509 - 86,571,878 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

FOXC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	66,234,336 - 66,296,007 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	66,294,176 - 66,295,693 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	66,246,461 - 66,254,587 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	66,455,805 - 66,464,138 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	5	66,479,102 - 66,487,010 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	66,314,300 - 66,322,205 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	66,727,335 - 66,735,464 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Foxc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	26,482,456 - 26,485,324 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	2,236,873 - 2,238,375 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	2,236,224 - 2,238,501 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	2,552,862 - 2,554,367 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	2,552,141 - 2,555,041 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	2,756,138 - 2,761,356 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	71,951,980 - 71,955,021 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	71,952,632 - 71,954,134 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	3,750,917 - 3,753,843 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	2,632,619 - 2,634,085 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	2,632,547 - 2,634,867 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Foxc2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	40,767,543 - 40,770,231 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	73
Count of miRNA genes:	64
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000072369
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
12	9	67	145	49	48	24	15	24	6	229	114	11	124	73	90	24	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001101680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L13193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000072369 ⟹ ENSRNOP00000065254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	66,094,700 - 66,153,977 (+)	Ensembl
mRatBN7.2 Ensembl	19	49,185,662 - 49,188,737 (+)	Ensembl
Rnor_6.0 Ensembl	19	53,044,379 - 53,047,081 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135576 ⟹ ENSRNOP00000109796

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	66,094,703 - 66,105,940 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000145349 ⟹ ENSRNOP00000099287

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	66,094,723 - 66,097,672 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000166484 ⟹ ENSRNOP00000112449

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	66,094,713 - 66,108,832 (+)	Ensembl

RefSeq Acc Id:

NM_001101680 ⟹ NP_001095150

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	66,094,718 - 66,097,420 (+)	NCBI
mRatBN7.2	19	49,186,034 - 49,188,736 (+)	NCBI
Rnor_6.0	19	53,044,379 - 53,047,081 (+)	NCBI
Rnor_5.0	19	63,788,037 - 63,790,739 (+)	NCBI
Celera	19	48,432,333 - 48,435,035 (+)	RGD

Sequence:

show sequence

AGGGACTTCGCTTCTTTTTCCGGGCTCGGCCGCGCAGCCTCTCCGGATCCCAGCTCGCGGACAC
TGTGGGCTGCCGTTCTCCTGGCGGAGCCCCGAGAGCCGCTGTCTCCTTTTCTAGCACTCCGAAG
GGCTGGTCTAGCTCCACGGTCGCGCGTGGCGTCTGTGCCGCCAGCTCAGGGCTTCCATCCGCCG
GTCCGAGAGCGCGCGGCCAGCCGGGCCGCCCGGGGTGCGCCCTCCAGGATGCTGATCCGCCCGG
TCGGCTGAACCCGAGCGCCAGCGCGCGTGGCCCGCGAGGCTGCCCCGAGCCAGGGCTGCCCGCA
TCGCTCCGTCCCTTCCTGCTCTCTTGCTCCGGGCCTCGCTCCCCGCGGGCCGCAGTCGGTGCGC
GCAGGCGGCGGCCGGGCGTCTGGGACGCAGCATGCAGGCGCGCTACTCGGTGTCGGACCCCAAC
GCCCTGGGAGTGGTACCCTACTTGAGCGAGCAAAACTACTACCGGGCGGCGGGCAGCTACGGCG
GCATGGCCAGCCCCATGGGCGTCTACTCCGGCCACCCGGAGCAGTACGGCGCCGGCATGGGCCG
CTCTTACGCGCCCTACCACCACCAGCCCGCGGCGCCCAAGGACCTGGTGAAGCCGCCCTACAGC
TACATAGCGCTCATCACCATGGCGATCCAGAACGCGCCGGAGAAGAAGATCACCCTGAACGGCA
TCTACCAGTTCATCATGGACCGTTTTCCCTTCTACCGCGAGAACAAGCAGGGCTGGCAGAACAG
CATCCGCCACAACCTGTCGCTCAACGAGTGCTTCGTGAAGGTGCCGCGCGATGACAAGAAGCCA
GGCAAAGGTAGCTACTGGACGCTCGACCCGGACTCCTACAATATGTTCGAGAACGGCAGCTTCC
TGCGGCGGCGGCGGCGCTTCAAGAAGAAGGACGTGCCCAAGGATAAGGAGGAGCGGGCCCACCT
CAAGGAGCCGCCCCCTGCCTCGGCCAAAGGCGCCCCGACAGGGACCCCGGTAGCTGACGGGCCC
AAGGAGGCCGAGAAGAAAGTGGTGGTCAAGAGCGAGGCGGCGTCACCCGCGCTGCCGGTCATCA
CCAAGGTGGAGACGCTGAGTCCCGAGGGCGCGCTGCAAGCCAGTCCCCGCAGCTCAGCCTCCAC
GCCTGCCGGCTCCCCAGACGGCTCGCTGCCGGAGCACCACGCCGCCGCGCCCAACGGGCTGCCC
GGCTTCAGCGTGGAGACCATCATGACGCTGCGCACGTCGCCTCCGGGCGGCGATCTGAGCCCAG
CGGCCGCGCGCGCCGGCCTGGTGGTGCCACCGCTGGCGCTGCCATACGCCGCAGCTCCACCAGC
CGCTTACGCACAGCCGTGCGCGCAGGGCCTGGAGGCTGCGGGCTCCGCGGGCTACCAGTGCAGC
ATGCGGGCTATGAGTCTGTACACCGGGGCCGAGCGGCCTGCGCACGTGTGCGTTCCGCCCGCGC
TGGACGAGGCTCTGTCGGACCACCCGAGCGGCCCCGGCTCCCCGCTCGGCGCCCTCAACCTCGC
AGCGGGTCAGGAGGGTGCGTTGGGGGCCTCGGGCCACCACCACCAGCATCACAGTCACCTCCAC
CCGCAGGCGCCGCCGCCCGCCCCGCAGCCCCCTCCCGCGCCGCAGCCCGCCACCCAGGCCACCT
CCTGGTATCTGAACCACGGCGGGGACCTGAGCCACCTCCCCGGCCACACGTTCGCGACCCAACA
GCAAACTTTCCCCAATGTCCGGGAGATGTTCAACTCGCACCGGCTAGGACTGGACAACTCGACC
CTCGGGGAGTCCCAGGTGAGCAATGCGAGCTGTCAGCTGCCCTACCGAGCTACGCCGTCCCTCT
ACCGCCATGCAGCCCCCTACTCCTACGACTGCACCAAATATTAAGGCGTCCAGTCCGCTCCAGC
CCCAGGCCCGCACCGGCTTCACCTCCCCATGGGACCTTCTTCGACAGAGCCGCAAAAAGCGACC
GAACGCGCCCCTCTCTCAGACCCGGGAGCAGAGAGCTCCGTGCATCTCGCAGGTAACTTCTCCG
CAGCTCAGTTTGAGATCCCAGAGAGTCCCTCTAACCGGGATGCAGCACAGCAAAACGAAATACC
GATTTATTTTTTTTTTTAATTCCCGTTCCCTGCCCGGATGCTGCGCCTGCTCCCCTTGGGGTTT
TAATAGATTGGTTTATGGACCAAACCCCACAGGGACCCCCTAATGACTTCTGTGGAGACTCTCC
CCGGGCTCAAGAGGTCTCTCCGGATAAGGTGCCTTCTGTAAACGAGTGCGGATTTGTAACCAGG
CGAGTTCGTTGTTACCCAGAGCCTTTAATATAATATTTAAAGTTGTGTCCACTGGATAAGGTTT
CATCTTGCCCAACTGTTACTGCCAAATTGAATTCAAGAAACCTGTGTGGGTCTTTTCTCCCCAC
AGTACCATAATAAAATAGGTTTTTCCCCCACAAATGAAGGTCTTTTACAAAACAAGAAAATAAT
TTATTTATTTTTTTGTTGTTGTTGGATAACGAAATTAAGTATTGGATACTTTTTATTTAGGAAG
CGCATGGCTTTGTACAGTAGACGCCATCTGGAGTATTCCTAAAACACACAAAGAGACTTTAAAA
TTTCAACTTCATCTGTGTTTGTCTTCTGTGATCTCAGTGTTGTATTTACCTTAAAATAAACCCA
CGTTGTTCTTCTGCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001095150	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41320	(Get FASTA)	NCBI Sequence Viewer
	EDL92716	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065254.1
	ENSRNOP00000099287
GenBank Protein	Q63246	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001095150 ⟸ NM_001101680

- UniProtKB:

M0R736 (UniProtKB/Swiss-Prot), Q63246 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYGAGMGRSYAPYHHQPA
APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPPASAKG
APTGTPVADGPKEAEKKVVVKSEAASPALPVITKVETLSPEGALQASPRSSASTPAGSPDGSLP
EHHAAAPNGLPGFSVETIMTLRTSPPGGDLSPAAARAGLVVPPLALPYAAAPPAAYAQPCAQGL
EAAGSAGYQCSMRAMSLYTGAERPAHVCVPPALDEALSDHPSGPGSPLGALNLAAGQEGALGAS
GHHHQHHSHLHPQAPPPAPQPPPAPQPATQATSWYLNHGGDLSHLPGHTFATQQQTFPNVREMF
NSHRLGLDNSTLGESQVSNASCQLPYRATPSLYRHAAPYSYDCTKY

hide sequence

Ensembl Acc Id:

ENSRNOP00000065254 ⟸ ENSRNOT00000072369

Ensembl Acc Id:

ENSRNOP00000109796 ⟸ ENSRNOT00000135576

Ensembl Acc Id:

ENSRNOP00000099287 ⟸ ENSRNOT00000145349

Ensembl Acc Id:

ENSRNOP00000112449 ⟸ ENSRNOT00000166484

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63246-F1-model_v2	AlphaFold	Q63246	1-494	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701190

Promoter ID:

EPDNEW_R11713

Type:

initiation region

Name:

Foxc2_1

Description:

forkhead box C2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	53,044,357 - 53,044,417	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621703	AgrOrtholog
BioCyc Gene	G2FUF-5453	BioCyc
Ensembl Genes	ENSRNOG00000047446	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000072369.2	UniProtKB/Swiss-Prot
	ENSRNOT00000145349	ENTREZGENE
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Fork_head_dom	UniProtKB/Swiss-Prot
	FOX_domain-containing	UniProtKB/Swiss-Prot
	FOXC1/C2-like_FH	UniProtKB/Swiss-Prot
	TF_fork_head_CS_1	UniProtKB/Swiss-Prot
	TF_fork_head_CS_2	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171356	UniProtKB/Swiss-Prot
NCBI Gene	171356	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/Swiss-Prot
	FORKHEAD BOX PROTEIN C2	UniProtKB/Swiss-Prot
Pfam	Forkhead	UniProtKB/Swiss-Prot
PhenoGen	Foxc2	PhenoGen
PRINTS	FORKHEAD	UniProtKB/Swiss-Prot
PROSITE	FORK_HEAD_1	UniProtKB/Swiss-Prot
	FORK_HEAD_2	UniProtKB/Swiss-Prot
	FORK_HEAD_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000047446	RatGTEx
SMART	SM00339	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	FOXC2_RAT	UniProtKB/Swiss-Prot
	M0R736	ENTREZGENE
	Q63246	ENTREZGENE
UniProt Secondary	M0R736	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Foxc2	forkhead box C2		forkhead box C2 (MFH-1, mesenchyme forkhead 1)	Name updated	1299863	APPROVED
2002-08-07	Foxc2	forkhead box C2 (MFH-1, mesenchyme forkhead 1)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	forkhead DNA-binding domain recognizes its cognate DNA binding site as a monomer	632667
gene_expression	mRNA expressed in liver, brain, kidney, lung, and intestine	632667
gene_homology	shares homology with Drosophila homeotic protein forkhead (fkh)	632667
gene_product	member of hepatocyte nuclear transcription factor (HNF) family	632667

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM