Symbol:
Foxc2
Name:
forkhead box C2
RGD ID:
621703
Description:
Enables DNA binding activity. Predicted to be involved in several processes, including insulin receptor signaling pathway; negative regulation of cold-induced thermogenesis; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including cell surface receptor signaling pathway; circulatory system development; and kidney development. Predicted to be located in nuclear body. Human ortholog(s) of this gene implicated in several diseases, including lymphedema; lymphedema-distichiasis syndrome; obesity; ptosis; and type 2 diabetes mellitus. Orthologous to human FOXC2 (forkhead box C2); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BF-3; brain factor 3; Fkh14; Fkhl14; forkhead box C2 (MFH-1 mesenchyme forkhead 1); forkhead box C2 (MFH-1, mesenchyme forkhead 1); forkhead box protein C2; HFH-BF-3; Hfhbf3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FOXC2 (forkhead box C2) RGD
RGD
Mus musculus (house mouse):
Foxc2 (forkhead box C2) RGD
RGD
Pan paniscus (bonobo/pygmy chimpanzee):
FOXC2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FOXC2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Foxc2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FOXC2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FOXC2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Foxc2 (forkhead box C2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
FOXC2 (forkhead box C2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Foxc2 (forkhead box C2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
croc
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
fkh-8
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
foxc2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 66,094,718 - 66,097,420 (+) NCBI GRCr8 mRatBN7.2 19 49,186,034 - 49,188,736 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 49,185,662 - 49,188,737 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 55,977,317 - 55,980,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 56,661,030 - 56,663,732 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 58,875,485 - 58,878,187 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 53,044,379 - 53,047,081 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 53,044,379 - 53,047,081 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 63,788,037 - 63,790,739 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 1 228,513,040 - 228,513,088 (-) NCBI Celera 19 48,432,333 - 48,435,035 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Foxc2 Rat 1,2-dimethylhydrazine increases expression ISO Foxc2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FOXC2 mRNA CTD PMID:22206623 Foxc2 Rat 17beta-estradiol multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of FOXC2 mRNA CTD PMID:30165855 Foxc2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Foxc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of FOXC2 mRNA CTD PMID:24058054 and PMID:26139165 Foxc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Foxc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FOXC2 mRNA CTD PMID:19933214 Foxc2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Foxc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the reaction [AHR protein binds to FOXC2 promoter] CTD PMID:19654925 Foxc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Foxc2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FOXC2 mRNA CTD PMID:21570461 Foxc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO FOXC2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FOXC2 mRNA CTD PMID:21296121 Foxc2 Rat 2-hydroxypropanoic acid decreases expression ISO FOXC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FOXC2 mRNA CTD PMID:30851411 Foxc2 Rat 2-palmitoylglycerol increases expression ISO FOXC2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of FOXC2 mRNA CTD PMID:37199045 Foxc2 Rat 4,4'-sulfonyldiphenol increases expression ISO Foxc2 (Mus musculus) 6480464 bisphenol S results in increased expression of FOXC2 mRNA CTD PMID:30951980 Foxc2 Rat 4,4'-sulfonyldiphenol increases methylation ISO Foxc2 (Mus musculus) 6480464 bisphenol S results in increased methylation of FOXC2 exon CTD PMID:33297965 Foxc2 Rat 5-aza-2'-deoxycytidine increases expression ISO Foxc2 (Mus musculus) 6480464 Decitabine results in increased expression of FOXC2 mRNA CTD PMID:27915011 Foxc2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of FOXC2 mRNA CTD PMID:24780913 Foxc2 Rat abacavir decreases expression ISO FOXC2 (Homo sapiens) 6480464 abacavir results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of FOXC2 mRNA CTD PMID:28959563 Foxc2 Rat aflatoxin B1 decreases methylation ISO FOXC2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FOXC2 gene CTD PMID:27153756 Foxc2 Rat aldrin increases expression ISO Foxc2 (Mus musculus) 6480464 Aldrin results in increased expression of FOXC2 mRNA CTD PMID:18579281 Foxc2 Rat all-trans-retinoic acid increases expression ISO FOXC2 (Homo sapiens) 6480464 Tretinoin results in increased expression of FOXC2 mRNA CTD PMID:21934132 Foxc2 Rat all-trans-retinoic acid multiple interactions ISO FOXC2 (Homo sapiens) 6480464 Tretinoin inhibits the reaction [[Chir 99021 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FOXC2 mRNA] CTD PMID:31711903 Foxc2 Rat all-trans-retinoic acid decreases expression ISO FOXC2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FOXC2 mRNA CTD PMID:35163327 Foxc2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FOXC2 mRNA CTD PMID:16483693 Foxc2 Rat arsenite(3-) increases methylation ISO FOXC2 (Homo sapiens) 6480464 arsenite results in increased methylation of FOXC2 promoter CTD PMID:23974009 Foxc2 Rat belinostat increases expression ISO FOXC2 (Homo sapiens) 6480464 belinostat results in increased expression of FOXC2 mRNA CTD PMID:26272509 Foxc2 Rat benzo[a]pyrene multiple interactions ISO Foxc2 (Mus musculus) 6480464 Benzo(a)pyrene affects the reaction [AHR protein binds to FOXC2 promoter] CTD PMID:19654925 Foxc2 Rat benzo[a]pyrene decreases methylation ISO FOXC2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of FOXC2 promoter CTD PMID:27901495 Foxc2 Rat benzo[a]pyrene affects methylation ISO FOXC2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FOXC2 exon CTD PMID:27901495 Foxc2 Rat benzo[a]pyrene increases expression ISO Foxc2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FOXC2 mRNA CTD PMID:22228805 Foxc2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO FOXC2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Foxc2 Rat bisphenol A affects methylation ISO Foxc2 (Mus musculus) 6480464 bisphenol A affects the methylation of FOXC2 promoter CTD PMID:27334623 Foxc2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FOXC2 mRNA CTD PMID:29323181 Foxc2 Rat bisphenol A increases expression ISO Foxc2 (Mus musculus) 6480464 bisphenol A results in increased expression of FOXC2 mRNA CTD PMID:30951980 and PMID:32156529 Foxc2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FOXC2 mRNA CTD PMID:30816183 more ... Foxc2 Rat bisphenol F increases expression ISO Foxc2 (Mus musculus) 6480464 bisphenol F results in increased expression of FOXC2 mRNA CTD PMID:30951980 Foxc2 Rat bisphenol F decreases expression ISO Foxc2 (Mus musculus) 6480464 bisphenol F results in decreased expression of FOXC2 mRNA CTD PMID:36706583 Foxc2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of FOXC2 mRNA CTD PMID:19167457 Foxc2 Rat cadmium dichloride decreases expression ISO FOXC2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of FOXC2 mRNA CTD PMID:38568856 Foxc2 Rat cannabidiol increases expression ISO FOXC2 (Homo sapiens) 6480464 Cannabidiol results in increased expression of FOXC2 mRNA CTD PMID:27918106 Foxc2 Rat CHIR 99021 multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [Chir 99021 co-treated with 4-(5-benzo(1 more ... CTD PMID:31711903 Foxc2 Rat choline multiple interactions ISO Foxc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXC2 gene CTD PMID:20938992 Foxc2 Rat chromium(6+) multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of FOXC2 mRNA CTD PMID:38479592 Foxc2 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of FOXC2 mRNA CTD PMID:17898221 Foxc2 Rat copper(II) chloride increases expression ISO FOXC2 (Homo sapiens) 6480464 cupric chloride results in increased expression of FOXC2 mRNA CTD PMID:38568856 Foxc2 Rat dabigatran decreases expression ISO FOXC2 (Homo sapiens) 6480464 Dabigatran results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat DDE increases activity ISO FOXC2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased activity of FOXC2 protein CTD PMID:27589886 Foxc2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of FOXC2 mRNA CTD PMID:23914054 Foxc2 Rat diallyl disulfide multiple interactions ISO FOXC2 (Homo sapiens) 6480464 diallyl disulfide inhibits the reaction [tobacco tar analog results in decreased expression of FOXC2 mRNA] CTD PMID:36758788 Foxc2 Rat dimethylselenide multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of FOXC2-AS1 mRNA] which results in decreased expression of FOXC2 mRNA and [[Ozone results in increased oxidation of dimethylselenide] which results in decreased expression of FOXC2-AS1 mRNA] which results in decreased expression of FOXC2 mRNA CTD PMID:33656867 Foxc2 Rat dioxygen increases expression ISO Foxc2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of FOXC2 mRNA CTD PMID:24205000 Foxc2 Rat dorsomorphin multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Foxc2 Rat doxorubicin decreases expression ISO FOXC2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of FOXC2 mRNA CTD PMID:29803840 Foxc2 Rat Doxylamine succinate decreases expression ISO FOXC2 (Homo sapiens) 6480464 doxylamine succinate results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of FOXC2 mRNA CTD PMID:29391264 Foxc2 Rat ethylene glycol decreases expression ISO FOXC2 (Homo sapiens) 6480464 Ethylene Glycol results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat folic acid multiple interactions ISO Foxc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXC2 gene CTD PMID:20938992 Foxc2 Rat folic acid decreases expression ISO Foxc2 (Mus musculus) 6480464 Folic Acid results in decreased expression of FOXC2 mRNA CTD PMID:25629700 Foxc2 Rat genistein increases expression ISO Foxc2 (Mus musculus) 6480464 Genistein results in increased expression of FOXC2 mRNA CTD PMID:32186404 Foxc2 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of FOXC2 mRNA CTD PMID:38314887 Foxc2 Rat hydrazines decreases expression ISO Foxc2 (Mus musculus) 6480464 Hydrazines results in decreased expression of FOXC2 mRNA CTD PMID:21647536 Foxc2 Rat hydroxyl multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of FOXC2-AS1 mRNA] which results in decreased expression of FOXC2 mRNA CTD PMID:33656867 Foxc2 Rat isotretinoin decreases expression ISO FOXC2 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat L-methionine multiple interactions ISO Foxc2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FOXC2 gene CTD PMID:20938992 Foxc2 Rat mercury dibromide multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FOXC2 mRNA CTD PMID:27188386 Foxc2 Rat methylmercury chloride increases expression ISO FOXC2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of FOXC2 mRNA CTD PMID:28001369 Foxc2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of FOXC2 mRNA CTD PMID:20360939 Foxc2 Rat nickel sulfate increases expression ISO Foxc2 (Mus musculus) 6480464 nickel sulfate results in increased expression of FOXC2 mRNA CTD PMID:16100012 Foxc2 Rat nilotinib decreases expression ISO FOXC2 (Homo sapiens) 6480464 nilotinib results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of FOXC2 mRNA CTD PMID:33484710 Foxc2 Rat ozone multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [[Ozone results in increased oxidation of dimethylselenide] which results in decreased expression of FOXC2-AS1 mRNA] which results in decreased expression of FOXC2 mRNA CTD PMID:33656867 Foxc2 Rat panobinostat increases expression ISO FOXC2 (Homo sapiens) 6480464 panobinostat results in increased expression of FOXC2 mRNA CTD PMID:26272509 Foxc2 Rat panobinostat multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FOXC2 mRNA CTD PMID:27188386 Foxc2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FOXC2 mRNA CTD PMID:35163327 Foxc2 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of FOXC2 mRNA CTD PMID:20360939 Foxc2 Rat phenylmercury acetate increases expression ISO FOXC2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of FOXC2 mRNA CTD PMID:26272509 Foxc2 Rat phenylmercury acetate multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FOXC2 mRNA CTD PMID:27188386 Foxc2 Rat phenytoin decreases expression ISO FOXC2 (Homo sapiens) 6480464 Phenytoin results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat pirinixic acid increases expression ISO Foxc2 (Mus musculus) 6480464 pirinixic acid results in increased expression of FOXC2 mRNA CTD PMID:20813756 Foxc2 Rat rac-lactic acid decreases expression ISO FOXC2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of FOXC2 mRNA CTD PMID:30851411 Foxc2 Rat resveratrol multiple interactions ISO Foxc2 (Mus musculus) 6480464 [Dietary Fats co-treated with Resveratrol] results in increased expression of FOXC2 mRNA CTD PMID:29197120 Foxc2 Rat SB 431542 multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [Chir 99021 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:31711903 Foxc2 Rat sodium arsenite decreases expression ISO FOXC2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FOXC2 mRNA CTD PMID:38568856 Foxc2 Rat sulforaphane decreases expression ISO FOXC2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of FOXC2 mRNA CTD PMID:31838189 Foxc2 Rat thalidomide decreases expression ISO FOXC2 (Homo sapiens) 6480464 Thalidomide results in decreased expression of FOXC2 mRNA CTD PMID:31711903 Foxc2 Rat titanium dioxide decreases methylation ISO Foxc2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FOXC2 gene CTD PMID:35295148 Foxc2 Rat trichostatin A increases expression ISO FOXC2 (Homo sapiens) 6480464 trichostatin A results in increased expression of FOXC2 mRNA CTD PMID:26272509 Foxc2 Rat trichostatin A multiple interactions ISO FOXC2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FOXC2 mRNA CTD PMID:27188386 Foxc2 Rat valproic acid increases expression ISO Foxc2 (Mus musculus) 6480464 Valproic Acid results in increased expression of FOXC2 mRNA CTD PMID:19136453 and PMID:21427059 Foxc2 Rat valproic acid increases expression ISO FOXC2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FOXC2 mRNA CTD PMID:23179753 Foxc2 Rat valproic acid decreases expression ISO FOXC2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of FOXC2 mRNA CTD PMID:31711903
1.
The FOXC2 C-512T polymorphism is associated with obesity and dyslipidemia.
Carlsson E, etal., Obes Res. 2004 Nov;12(11):1738-43.
2.
FOXC2 is a winged helix gene that counteracts obesity, hypertriglyceridemia, and diet-induced insulin resistance.
Cederberg A, etal., Cell. 2001 Sep 7;106(5):563-73.
3.
Identification of nine tissue-specific transcription factors of the hepatocyte nuclear factor 3/forkhead DNA-binding-domain family.
Clevidence DE, etal., Proc Natl Acad Sci U S A 1993 May 1;90(9):3948-52.
4.
Truncating mutations in FOXC2 cause multiple lymphedema syndromes.
Finegold DN, etal., Hum Mol Genet. 2001 May 15;10(11):1185-9.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Transcriptional genomics associates FOX transcription factors with human heart failure.
Hannenhalli S, etal., Circulation. 2006 Sep 19;114(12):1269-76. Epub 2006 Sep 4.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Systematic search for single nucleotide polymorphisms in the FOXC2 gene: the absence of evidence for the association of three frequent single nucleotide polymorphisms and four common haplotypes with Japanese type 2 diabetes.
Osawa H, etal., Diabetes. 2003 Feb;52(2):562-7.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
FOXC2 mRNA Expression and a 5' untranslated region polymorphism of the gene are associated with insulin resistance.
Ridderstrale M, etal., Diabetes. 2002 Dec;51(12):3554-60.
14.
A novel frameshift mutation of FOXC2 gene in a family with hereditary lymphedema-distichiasis syndrome associated with renal disease and diabetes mellitus.
Yildirim-Toruner C, etal., Am J Med Genet A. 2004 Dec 15;131(3):281-6.
Foxc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 66,094,718 - 66,097,420 (+) NCBI GRCr8 mRatBN7.2 19 49,186,034 - 49,188,736 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 49,185,662 - 49,188,737 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 55,977,317 - 55,980,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 56,661,030 - 56,663,732 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 58,875,485 - 58,878,187 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 53,044,379 - 53,047,081 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 53,044,379 - 53,047,081 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 63,788,037 - 63,790,739 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 1 228,513,040 - 228,513,088 (-) NCBI Celera 19 48,432,333 - 48,435,035 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
FOXC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 86,566,829 - 86,569,728 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 86,566,829 - 86,569,728 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 86,600,435 - 86,603,334 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 85,158,443 - 85,159,948 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 85,158,442 - 85,159,948 NCBI Celera 16 70,901,820 - 70,903,503 (+) NCBI Celera Cytogenetic Map 16 q24.1 NCBI HuRef 16 72,340,749 - 72,342,345 (+) NCBI HuRef CHM1_1 16 88,012,585 - 88,014,267 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 92,635,146 - 92,638,044 (+) NCBI T2T-CHM13v2.0
Foxc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 121,842,910 - 121,845,634 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 121,842,910 - 121,845,634 (+) Ensembl GRCm39 Ensembl GRCm38 8 121,116,171 - 121,118,895 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 121,116,171 - 121,118,895 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 123,640,071 - 123,642,795 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 124,002,560 - 124,004,872 (+) NCBI MGSCv36 mm8 Celera 8 125,334,251 - 125,336,975 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 70.33 NCBI
FOXC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 96,322,973 - 96,325,904 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 102,240,170 - 102,243,107 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 67,237,476 - 67,239,545 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 86,569,509 - 86,571,878 (+) NCBI panpan1.1 PanPan1.1 panPan2
FOXC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 66,234,336 - 66,296,007 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 66,294,176 - 66,295,693 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 66,246,461 - 66,254,587 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 66,455,805 - 66,464,138 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 5 66,479,102 - 66,487,010 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 66,314,300 - 66,322,205 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 66,727,335 - 66,735,464 (-) NCBI UU_Cfam_GSD_1.0
Foxc2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 26,482,456 - 26,485,324 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936641 2,236,873 - 2,238,375 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936641 2,236,224 - 2,238,501 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FOXC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 2,552,862 - 2,554,367 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 2,552,141 - 2,555,041 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 2,756,138 - 2,761,356 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FOXC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 71,951,980 - 71,955,021 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 71,952,632 - 71,954,134 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 3,750,917 - 3,753,843 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Foxc2
.
Predicted Target Of
Count of predictions: 73 Count of miRNA genes: 64 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000072369 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
8
49
113
49
48
24
10
24
6
164
81
93
45
58
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000072369 ⟹ ENSRNOP00000065254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 49,185,662 - 49,188,737 (+) Ensembl Rnor_6.0 Ensembl 19 53,044,379 - 53,047,081 (+) Ensembl
RefSeq Acc Id:
NM_001101680 ⟹ NP_001095150
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 66,094,718 - 66,097,420 (+) NCBI mRatBN7.2 19 49,186,034 - 49,188,736 (+) NCBI Rnor_6.0 19 53,044,379 - 53,047,081 (+) NCBI Rnor_5.0 19 63,788,037 - 63,790,739 (+) NCBI Celera 19 48,432,333 - 48,435,035 (+) RGD
Sequence:
AGGGACTTCGCTTCTTTTTCCGGGCTCGGCCGCGCAGCCTCTCCGGATCCCAGCTCGCGGACACTGTGGGCTGCCGTTCTCCTGGCGGAGCCCCGAGAGCCGCTGTCTCCTTTTCTAGCACTCCGAAG
hide sequence
RefSeq Acc Id:
NP_001095150 ⟸ NM_001101680
- UniProtKB:
M0R736 (UniProtKB/Swiss-Prot), Q63246 (UniProtKB/Swiss-Prot)
- Sequence:
MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYGAGMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
hide sequence
Ensembl Acc Id:
ENSRNOP00000065254 ⟸ ENSRNOT00000072369
RGD ID: 13701190 Promoter ID: EPDNEW_R11713 Type: initiation region Name: Foxc2_1 Description: forkhead box C2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 53,044,357 - 53,044,417 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Foxc2
forkhead box C2
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Name updated
1299863 APPROVED
2002-08-07
Foxc2
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
forkhead DNA-binding domain recognizes its cognate DNA binding site as a monomer
632667
gene_expression
mRNA expressed in liver, brain, kidney, lung, and intestine
632667
gene_homology
shares homology with Drosophila homeotic protein forkhead (fkh)
632667
gene_product
member of hepatocyte nuclear transcription factor (HNF) family
632667
