Symbol:
Asah1
Name:
N-acylsphingosine amidohydrolase 1
RGD ID:
621568
Description:
Predicted to enable N-acylsphingosine amidohydrolase activity; nuclear receptor binding activity; and transcription corepressor activity. Involved in lung development. Predicted to be located in extracellular space; lysosome; and nucleus. Human ortholog(s) of this gene implicated in Farber lipogranulomatosis; sphingolipidosis; and spinal muscular atrophy with progressive myoclonic epilepsy. Orthologous to human ASAH1 (N-acylsphingosine amidohydrolase 1); PARTICIPATES IN ceramide signaling pathway; sphingolipid metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
AC; ACDase; acid CDase; acid ceramidase; acylsphingosine deacylase; Asah; N-acylethanolamine hydrolase ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase); N-acylsphingosine amidohydrolase (acid ceramidase) 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ASAH1 (N-acylsphingosine amidohydrolase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Asah1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Asah1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ASAH1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ASAH1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Asah1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ASAH1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ASAH1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Asah1 (N-acylsphingosine amidohydrolase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ASAH1 (N-acylsphingosine amidohydrolase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Asah1 (N-acylsphingosine amidohydrolase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
asah1a (N-acylsphingosine amidohydrolase (acid ceramidase) 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
asah1b (N-acylsphingosine amidohydrolase (acid ceramidase) 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
asah-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
asah-2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
asah1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 57,669,927 - 57,701,349 (+) NCBI GRCr8 mRatBN7.2 16 50,966,404 - 50,997,827 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 50,966,229 - 51,008,233 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 56,286,045 - 56,317,559 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 59,685,411 - 59,716,841 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 54,919,980 - 54,951,496 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 53,998,604 - 54,030,006 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 53,998,560 - 54,040,836 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 53,712,315 - 53,743,717 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 54,279,253 - 54,311,084 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 54,279,327 - 54,311,158 (+) NCBI Celera 16 48,861,616 - 48,893,051 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Asah1 Rat 1,1-dichloroethene increases expression ISO Asah1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of ASAH1 mRNA CTD PMID:26682919 Asah1 Rat 1,2-dichloroethane decreases expression ISO Asah1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ASAH1 mRNA CTD PMID:28960355 Asah1 Rat 1,2-dimethylhydrazine multiple interactions ISO Asah1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ASAH1 mRNA CTD PMID:22206623 Asah1 Rat 1,2-dimethylhydrazine decreases expression ISO Asah1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ASAH1 mRNA CTD PMID:22206623 Asah1 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression ISO ASAH1 (Homo sapiens) 6480464 chlorcyclizine results in increased expression of ASAH1 mRNA CTD PMID:15342952 Asah1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ASAH1 mRNA CTD PMID:25380136 Asah1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ASAH1 mRNA CTD PMID:16174780 Asah1 Rat 17alpha-ethynylestradiol increases expression ISO Asah1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ASAH1 mRNA CTD PMID:17942748 Asah1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ASAH1 mRNA CTD PMID:32145629 Asah1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ASAH1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ASAH1 mRNA CTD PMID:29581250 Asah1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ASAH1 mRNA CTD PMID:21215274 and PMID:32109520 Asah1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ASAH1 mRNA CTD PMID:34747641 Asah1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ASAH1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ASAH1 mRNA CTD PMID:23152189 Asah1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Asah1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ASAH1 mRNA CTD PMID:21570461 Asah1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Asah1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression ISO Asah1 (Mus musculus) 6480464 2 more ... CTD PMID:34097992 Asah1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ASAH1 mRNA CTD PMID:21346803 Asah1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ASAH1 mRNA CTD PMID:30071829 Asah1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of ASAH1 mRNA CTD PMID:19162173 Asah1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ASAH1 mRNA CTD PMID:25380136 Asah1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Asah1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ASAH1 mRNA CTD PMID:39298647 Asah1 Rat 4,4'-sulfonyldiphenol increases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ASAH1 protein CTD PMID:34186270 Asah1 Rat 5-fluorouracil affects response to substance ISO ASAH1 (Homo sapiens) 6480464 ASAH1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Asah1 Rat 5-fluorouracil multiple interactions ISO ASAH1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of ASAH1 mRNA] CTD PMID:15016801 Asah1 Rat 7,12-dimethyltetraphene affects expression ISO Asah1 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Asah1 Rat 8'-apo-beta,psi-caroten-8'-al increases expression ISO ASAH1 (Homo sapiens) 6480464 apocarotenal results in increased expression of ASAH1 mRNA CTD PMID:17034753 Asah1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ASAH1 mRNA CTD PMID:31881176 Asah1 Rat acrolein multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ASAH1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of ASAH1 mRNA CTD PMID:32699268 Asah1 Rat all-trans-retinoic acid increases expression ISO ASAH1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ASAH1 mRNA CTD PMID:21934132 and PMID:33167477 Asah1 Rat alpha-pinene multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ASAH1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of ASAH1 mRNA CTD PMID:32699268 Asah1 Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of ASAH1 mRNA CTD PMID:19224547 Asah1 Rat amiodarone increases expression ISO ASAH1 (Homo sapiens) 6480464 Amiodarone results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17567588 Asah1 Rat amitriptyline increases expression ISO ASAH1 (Homo sapiens) 6480464 Amitriptyline results in increased expression of ASAH1 mRNA CTD PMID:15342952 more ... Asah1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ASAH1 mRNA CTD PMID:16483693 Asah1 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of ASAH1 protein CTD PMID:30545405 Asah1 Rat Aroclor 1254 decreases expression ISO Asah1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ASAH1 mRNA CTD PMID:23650126 Asah1 Rat arsenous acid increases expression ISO ASAH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ASAH1 mRNA CTD PMID:20458559 and PMID:27829220 Asah1 Rat azoxystrobin increases expression ISO ASAH1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of ASAH1 mRNA CTD PMID:33512557 Asah1 Rat benzo[a]pyrene increases mutagenesis ISO ASAH1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ASAH1 gene CTD PMID:25435355 Asah1 Rat benzo[a]pyrene affects methylation ISO ASAH1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ASAH1 promoter CTD PMID:27901495 Asah1 Rat benzo[a]pyrene affects expression ISO Asah1 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of ASAH1 mRNA CTD PMID:22342234 Asah1 Rat benzo[a]pyrene increases expression ISO Asah1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ASAH1 mRNA CTD PMID:22228805 Asah1 Rat benzo[a]pyrene diol epoxide I increases expression ISO ASAH1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Asah1 Rat beta-carotene increases expression ISO ASAH1 (Homo sapiens) 6480464 beta Carotene results in increased expression of ASAH1 mRNA CTD PMID:17034753 Asah1 Rat beta-lapachone increases expression ISO ASAH1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ASAH1 mRNA CTD PMID:38218311 Asah1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Asah1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ASAH1 mRNA CTD PMID:34319233 Asah1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Asah1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ASAH1 mRNA CTD PMID:33754040 Asah1 Rat bisphenol A decreases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ASAH1 mRNA and bisphenol A results in decreased expression of ASAH1 protein CTD PMID:19371625 and PMID:34186270 Asah1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ASAH1 mRNA and bisphenol A results in decreased expression of ASAH1 protein CTD PMID:32145629 and PMID:34947998 Asah1 Rat bisphenol A affects expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol A affects the expression of ASAH1 mRNA CTD PMID:30903817 Asah1 Rat bisphenol A decreases methylation ISO ASAH1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ASAH1 gene CTD PMID:28582417 Asah1 Rat bisphenol A increases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ASAH1 mRNA and bisphenol A results in increased expression of ASAH1 protein CTD PMID:29275510 and PMID:37567409 Asah1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ASAH1 gene CTD PMID:28505145 Asah1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ASAH1 mRNA CTD PMID:25181051 and PMID:33296240 Asah1 Rat bisphenol AF increases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ASAH1 protein CTD PMID:34186270 Asah1 Rat Bisphenol B increases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ASAH1 protein CTD PMID:34186270 Asah1 Rat bisphenol F increases expression ISO ASAH1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ASAH1 protein CTD PMID:34186270 Asah1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of ASAH1 promoter CTD PMID:22457795 Asah1 Rat cannabidiol decreases expression ISO Asah1 (Mus musculus) 6480464 Cannabidiol results in decreased expression of ASAH1 mRNA CTD PMID:31052254 Asah1 Rat carbamazepine affects expression ISO ASAH1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ASAH1 mRNA CTD PMID:25979313 Asah1 Rat carbon nanotube increases expression ISO Asah1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ASAH1 mRNA CTD PMID:25554681 Asah1 Rat carbon nanotube decreases expression ISO Asah1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of ASAH1 mRNA CTD PMID:25620056 Asah1 Rat CGP 52608 multiple interactions ISO ASAH1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ASAH1 gene] CTD PMID:28238834 Asah1 Rat chlorpromazine increases expression ISO ASAH1 (Homo sapiens) 6480464 Chlorpromazine results in increased expression of ASAH1 mRNA CTD PMID:17175557 Asah1 Rat cisplatin multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ASAH1 mRNA CTD PMID:27392435 Asah1 Rat clarithromycin increases expression ISO ASAH1 (Homo sapiens) 6480464 Clarithromycin results in increased expression of ASAH1 mRNA CTD PMID:15342952 Asah1 Rat clofibrate increases expression ISO Asah1 (Mus musculus) 6480464 Clofibrate results in increased expression of ASAH1 mRNA CTD PMID:25270620 Asah1 Rat clozapine increases expression ISO ASAH1 (Homo sapiens) 6480464 Clozapine results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17175557 Asah1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ASAH1 protein CTD PMID:24386269 Asah1 Rat copper(II) sulfate decreases expression ISO ASAH1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ASAH1 mRNA CTD PMID:19549813 Asah1 Rat crocidolite asbestos decreases expression ISO Asah1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of ASAH1 mRNA CTD PMID:29279043 Asah1 Rat cyclosporin A decreases expression ISO ASAH1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ASAH1 mRNA CTD PMID:25562108 Asah1 Rat cyproconazole increases expression ISO Asah1 (Mus musculus) 6480464 cyproconazole results in increased expression of ASAH1 mRNA CTD PMID:22334560 Asah1 Rat diarsenic trioxide increases expression ISO ASAH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ASAH1 mRNA CTD PMID:20458559 and PMID:27829220 Asah1 Rat Dibutyl phosphate affects expression ISO ASAH1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ASAH1 mRNA CTD PMID:37042841 Asah1 Rat dicrotophos decreases expression ISO ASAH1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ASAH1 mRNA CTD PMID:28302478 Asah1 Rat diethylstilbestrol increases expression ISO ASAH1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of ASAH1 mRNA CTD PMID:36621641 Asah1 Rat disopyramide increases expression ISO ASAH1 (Homo sapiens) 6480464 Disopyramide results in increased expression of ASAH1 mRNA CTD PMID:15342952 Asah1 Rat dorsomorphin multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASAH1 mRNA CTD PMID:27188386 Asah1 Rat epoxiconazole increases expression ISO Asah1 (Mus musculus) 6480464 epoxiconazole results in increased expression of ASAH1 mRNA CTD PMID:22334560 Asah1 Rat erythromycin A increases expression ISO ASAH1 (Homo sapiens) 6480464 Erythromycin results in increased expression of ASAH1 mRNA CTD PMID:17175557 Asah1 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of ASAH1 mRNA CTD PMID:17347304 Asah1 Rat ethanol affects splicing ISO Asah1 (Mus musculus) 6480464 Ethanol affects the splicing of ASAH1 mRNA CTD PMID:30319688 Asah1 Rat etoposide affects response to substance ISO ASAH1 (Homo sapiens) 6480464 ASAH1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Asah1 Rat fenamidone increases expression ISO Asah1 (Mus musculus) 6480464 fenamidone results in increased expression of ASAH1 mRNA CTD PMID:27029645 Asah1 Rat fenfluramine increases expression ISO ASAH1 (Homo sapiens) 6480464 Fenfluramine results in increased expression of ASAH1 mRNA CTD PMID:22140631 Asah1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of ASAH1 mRNA CTD PMID:18035473 Asah1 Rat flecainide increases expression ISO ASAH1 (Homo sapiens) 6480464 Flecainide results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17175557 Asah1 Rat fluoxetine increases expression ISO ASAH1 (Homo sapiens) 6480464 Fluoxetine results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17567588 Asah1 Rat folic acid decreases expression ISO Asah1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ASAH1 mRNA CTD PMID:25629700 Asah1 Rat folic acid multiple interactions ISO Asah1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ASAH1 mRNA CTD PMID:22206623 Asah1 Rat gamma-linolenic acid increases expression ISO ASAH1 (Homo sapiens) 6480464 gamma-Linolenic Acid results in increased expression of ASAH1 mRNA CTD PMID:20664735 Asah1 Rat genistein decreases expression ISO ASAH1 (Homo sapiens) 6480464 Genistein results in decreased expression of ASAH1 mRNA CTD PMID:19371625 Asah1 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of ASAH1 protein CTD PMID:30545405 Asah1 Rat gold atom decreases expression ISO ASAH1 (Homo sapiens) 6480464 Gold analog results in decreased expression of ASAH1 mRNA CTD PMID:36057382 Asah1 Rat gold(0) decreases expression ISO ASAH1 (Homo sapiens) 6480464 Gold analog results in decreased expression of ASAH1 mRNA CTD PMID:36057382 Asah1 Rat hydrogen peroxide increases expression ISO ASAH1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of ASAH1 protein CTD PMID:34581912 Asah1 Rat imipramine increases expression ISO ASAH1 (Homo sapiens) 6480464 Imipramine results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17567588 Asah1 Rat ivermectin decreases expression ISO ASAH1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ASAH1 protein CTD PMID:32959892 Asah1 Rat lead diacetate increases expression ISO Asah1 (Mus musculus) 6480464 lead acetate results in increased expression of ASAH1 mRNA CTD PMID:21829687 Asah1 Rat lead(0) affects expression ISO ASAH1 (Homo sapiens) 6480464 Lead affects the expression of ASAH1 mRNA CTD PMID:28903495 Asah1 Rat manganese atom multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASAH1 mRNA CTD PMID:39836092 Asah1 Rat manganese(0) multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASAH1 mRNA CTD PMID:39836092 Asah1 Rat manganese(II) chloride multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASAH1 mRNA CTD PMID:39836092 Asah1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of ASAH1 mRNA CTD PMID:28935588 Asah1 Rat methapyrilene increases expression ISO ASAH1 (Homo sapiens) 6480464 Methapyrilene results in increased expression of ASAH1 mRNA CTD PMID:28935588 Asah1 Rat methidathion decreases expression ISO Asah1 (Mus musculus) 6480464 methidathion results in decreased expression of ASAH1 mRNA CTD PMID:34813904 Asah1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ASAH1 gene CTD PMID:35440735 Asah1 Rat methyl methanesulfonate increases expression ISO ASAH1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ASAH1 mRNA CTD PMID:23649840 Asah1 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of ASAH1 protein CTD PMID:30545405 Asah1 Rat mitomycin C affects response to substance ISO ASAH1 (Homo sapiens) 6480464 ASAH1 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Asah1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ASAH1 mRNA CTD PMID:19638242 Asah1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of ASAH1 mRNA CTD PMID:25380136 Asah1 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of ASAH1 protein CTD PMID:30545405 Asah1 Rat nickel sulfate decreases expression ISO ASAH1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of ASAH1 mRNA CTD PMID:16780908 Asah1 Rat ofloxacin increases expression ISO ASAH1 (Homo sapiens) 6480464 Ofloxacin results in increased expression of ASAH1 mRNA CTD PMID:17175557 Asah1 Rat ouabain affects expression ISO ASAH1 (Homo sapiens) 6480464 Ouabain affects the expression of ASAH1 protein CTD PMID:17268060 Asah1 Rat ozone multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ASAH1 mRNA more ... CTD PMID:32699268 Asah1 Rat ozone multiple interactions ISO Asah1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ASAH1 mRNA CTD PMID:34911549 Asah1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of ASAH1 mRNA CTD PMID:27638505 Asah1 Rat paracetamol increases expression ISO ASAH1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ASAH1 mRNA CTD PMID:22230336 Asah1 Rat perhexiline increases expression ISO ASAH1 (Homo sapiens) 6480464 Perhexiline results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17175557 Asah1 Rat phenylmercury acetate increases expression ISO ASAH1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ASAH1 mRNA CTD PMID:26272509 Asah1 Rat phenylmercury acetate multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASAH1 mRNA CTD PMID:27188386 Asah1 Rat picoxystrobin increases expression ISO ASAH1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of ASAH1 mRNA CTD PMID:33512557 Asah1 Rat propiconazole increases expression ISO Asah1 (Mus musculus) 6480464 propiconazole results in increased expression of ASAH1 mRNA CTD PMID:22334560 Asah1 Rat protein kinase inhibitor multiple interactions ISO ASAH1 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of ASAH1 mRNA] CTD PMID:28003376 Asah1 Rat quercetin increases expression ISO ASAH1 (Homo sapiens) 6480464 Quercetin results in increased expression of ASAH1 mRNA CTD PMID:21632981 Asah1 Rat resveratrol decreases expression ISO ASAH1 (Homo sapiens) 6480464 resveratrol results in decreased expression of ASAH1 mRNA CTD PMID:19371625 Asah1 Rat rotenone increases expression ISO Asah1 (Mus musculus) 6480464 Rotenone results in increased expression of ASAH1 mRNA CTD PMID:23186747 Asah1 Rat SB 431542 multiple interactions ISO ASAH1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASAH1 mRNA CTD PMID:27188386 Asah1 Rat sertraline increases expression ISO ASAH1 (Homo sapiens) 6480464 Sertraline results in increased expression of ASAH1 mRNA CTD PMID:15342952 Asah1 Rat sodium arsenite affects expression ISO ASAH1 (Homo sapiens) 6480464 sodium arsenite affects the expression of ASAH1 mRNA CTD PMID:20816728 Asah1 Rat sodium arsenite increases expression ISO Asah1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ASAH1 mRNA CTD PMID:36209798 Asah1 Rat sodium arsenite increases expression ISO ASAH1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ASAH1 mRNA CTD PMID:38568856 Asah1 Rat sodium fluoride decreases expression ISO Asah1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ASAH1 protein CTD PMID:28918527 Asah1 Rat sotalol increases expression ISO ASAH1 (Homo sapiens) 6480464 Sotalol results in increased expression of ASAH1 mRNA CTD PMID:17175557 Asah1 Rat sulindac sulfide decreases expression ISO ASAH1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of ASAH1 mRNA CTD PMID:16184548 Asah1 Rat tamoxifen increases expression ISO ASAH1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of ASAH1 mRNA CTD PMID:15342952 more ... Asah1 Rat tetrachloromethane affects expression ISO Asah1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of ASAH1 mRNA CTD PMID:31919559 Asah1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ASAH1 mRNA CTD PMID:23411599 and PMID:34492290 Asah1 Rat thioridazine increases expression ISO ASAH1 (Homo sapiens) 6480464 Thioridazine results in increased expression of ASAH1 mRNA CTD PMID:17175557 Asah1 Rat thiram decreases expression ISO ASAH1 (Homo sapiens) 6480464 Thiram results in decreased expression of ASAH1 mRNA CTD PMID:38568856 Asah1 Rat titanium dioxide decreases methylation ISO Asah1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ASAH1 gene and titanium dioxide results in decreased methylation of ASAH1 promoter CTD PMID:35295148 Asah1 Rat triphenyl phosphate affects expression ISO ASAH1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ASAH1 mRNA CTD PMID:37042841 Asah1 Rat valproic acid affects expression ISO ASAH1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ASAH1 mRNA CTD PMID:25979313 Asah1 Rat valproic acid increases expression ISO ASAH1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ASAH1 mRNA CTD PMID:23179753 more ... Asah1 Rat valproic acid decreases methylation ISO ASAH1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ASAH1 gene CTD PMID:29154799 Asah1 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in decreased expression of ASAH1 protein CTD PMID:30545405 Asah1 Rat Yessotoxin increases expression ISO ASAH1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of ASAH1 mRNA CTD PMID:30679557 Asah1 Rat zearalenone decreases expression ISO ASAH1 (Homo sapiens) 6480464 Zearalenone results in decreased expression of ASAH1 mRNA CTD PMID:19371625 Asah1 Rat zimeldine increases expression ISO ASAH1 (Homo sapiens) 6480464 Zimeldine results in increased expression of ASAH1 mRNA CTD PMID:15342952 and PMID:17175557
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP,ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) 8'-apo-beta,psi-caroten-8'-al (ISO) acetamide (EXP) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (EXP,ISO) amitriptyline (ISO) ammonium chloride (EXP) ampicillin (EXP) Aroclor 1254 (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-carotene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (EXP) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpromazine (ISO) cisplatin (ISO) clarithromycin (ISO) clofibrate (ISO) clozapine (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyproconazole (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) disopyramide (ISO) dorsomorphin (ISO) epoxiconazole (ISO) erythromycin A (ISO) ethanol (EXP,ISO) etoposide (ISO) fenamidone (ISO) fenfluramine (ISO) flavonoids (EXP) flecainide (ISO) fluoxetine (ISO) folic acid (ISO) gamma-linolenic acid (ISO) genistein (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) hydrogen peroxide (ISO) imipramine (ISO) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP,ISO) methidathion (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) metronidazole (EXP) mitomycin C (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) neomycin (EXP) nickel sulfate (ISO) ofloxacin (ISO) ouabain (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) perhexiline (ISO) phenylmercury acetate (ISO) picoxystrobin (ISO) propiconazole (ISO) protein kinase inhibitor (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sertraline (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sotalol (ISO) sulindac sulfide (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thioridazine (ISO) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vancomycin (EXP) Yessotoxin (ISO) zearalenone (ISO) zimeldine (ISO)
Biological Process
cellular response to tumor necrosis factor (IEA,ISO,ISS) ceramide biosynthetic process (ISO,ISS) ceramide catabolic process (IEA,ISO,ISS) fatty acid metabolic process (IEA) keratinocyte differentiation (ISO,ISS) lipid metabolic process (IEA) lung development (IDA) regulation of programmed necrotic cell death (IEA,ISO,ISS) regulation of steroid biosynthetic process (ISO,ISS) sphingolipid metabolic process (IEA) sphingosine biosynthetic process (IEA,ISO,ISS)
1.
Molecular analysis of acid ceramidase deficiency in patients with Farber disease.
Bar J, etal., Hum Mutat 2001 Mar;17(3):199-209.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Design, synthesis and activity as acid ceramidase inhibitors of 2-oxooctanoyl and N-oleoylethanolamine analogues.
Grijalvo S, etal., Chem Phys Lipids. 2006 Oct;144(1):69-84. Epub 2006 Aug 7.
5.
Insertional mutagenesis of the mouse acid ceramidase gene leads to early embryonic lethality in homozygotes and progressive lipid storage disease in heterozygotes.
Li CM, etal., Genomics 2002 Feb;79(2):218-24.
6.
Sphingomyelin metabolism is developmentally regulated in rat lung.
Longo CA, etal., Am J Respir Cell Mol Biol. 1997 May;16(5):605-12.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Asah1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 57,669,927 - 57,701,349 (+) NCBI GRCr8 mRatBN7.2 16 50,966,404 - 50,997,827 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 50,966,229 - 51,008,233 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 56,286,045 - 56,317,559 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 59,685,411 - 59,716,841 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 54,919,980 - 54,951,496 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 53,998,604 - 54,030,006 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 53,998,560 - 54,040,836 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 53,712,315 - 53,743,717 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 54,279,253 - 54,311,084 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 54,279,327 - 54,311,158 (+) NCBI Celera 16 48,861,616 - 48,893,051 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI
ASAH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 18,055,992 - 18,084,961 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 18,055,992 - 18,084,998 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 17,913,501 - 17,942,470 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 17,958,214 - 17,986,787 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 17,958,220 - 17,985,900 NCBI Celera 8 16,879,836 - 16,908,397 (-) NCBI Celera Cytogenetic Map 8 p22 NCBI HuRef 8 16,458,203 - 16,486,822 (-) NCBI HuRef CHM1_1 8 18,115,374 - 18,143,960 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 18,323,470 - 18,352,414 (-) NCBI T2T-CHM13v2.0
Asah1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 41,793,683 - 41,850,681 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 41,793,234 - 41,827,810 (-) Ensembl GRCm39 Ensembl GRCm38 8 41,340,646 - 41,397,644 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 41,340,197 - 41,374,773 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 42,425,997 - 42,460,051 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 42,839,482 - 42,873,444 (-) NCBI MGSCv36 mm8 Celera 8 43,964,022 - 43,997,069 (-) NCBI Celera Cytogenetic Map 8 A4 NCBI cM Map 8 23.89 NCBI
Asah1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955552 1,623,738 - 1,659,086 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955552 1,623,263 - 1,660,285 (+) NCBI ChiLan1.0 ChiLan1.0
ASAH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 36,528,846 - 36,557,133 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 12,254,484 - 12,282,710 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 17,272,632 - 17,300,902 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 14,226,156 - 14,254,155 (-) NCBI panpan1.1 PanPan1.1 panPan2
ASAH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 41,297,215 - 41,335,521 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 41,297,809 - 41,323,078 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 41,806,175 - 41,854,360 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 43,355,806 - 43,404,107 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 43,355,801 - 43,404,134 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 41,448,325 - 41,495,377 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 41,993,731 - 42,041,788 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 42,187,013 - 42,233,873 (-) NCBI UU_Cfam_GSD_1.0
Asah1
ASAH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 5,712,058 - 5,758,821 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 5,712,048 - 5,749,811 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 6,296,192 - 6,333,787 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ASAH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 16,151,974 - 16,181,726 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 16,151,247 - 16,181,155 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 26,094,678 - 26,124,159 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Asah1
.
Predicted Target Of
Count of predictions: 123 Count of miRNA genes: 99 Interacting mature miRNAs: 114 Transcripts: ENSRNOT00000013463 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 1298529 Arunc1 Aerobic running capacity QTL 1 4 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 31951520 60148445 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
RH144085
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 50,988,361 - 50,988,616 (+) MAPPER mRatBN7.2 Rnor_6.0 16 54,020,542 - 54,020,796 NCBI Rnor6.0 Rnor_5.0 16 53,734,253 - 53,734,507 UniSTS Rnor5.0 RGSC_v3.4 16 54,301,620 - 54,301,874 UniSTS RGSC3.4 Celera 16 48,883,679 - 48,883,933 UniSTS RH 3.4 Map 16 523.9 UniSTS Cytogenetic Map 16 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013463 ⟹ ENSRNOP00000013463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 50,966,372 - 50,997,839 (+) Ensembl Rnor_6.0 Ensembl 16 53,998,604 - 54,030,005 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077188 ⟹ ENSRNOP00000074724
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 50,966,229 - 51,008,233 (+) Ensembl Rnor_6.0 Ensembl 16 53,998,560 - 54,040,836 (+) Ensembl
RefSeq Acc Id:
NM_053407 ⟹ NP_445859
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 57,669,927 - 57,701,349 (+) NCBI mRatBN7.2 16 50,966,404 - 50,997,827 (+) NCBI Rnor_6.0 16 53,998,604 - 54,030,006 (+) NCBI Rnor_5.0 16 53,712,315 - 53,743,717 (+) NCBI RGSC_v3.4 16 54,279,253 - 54,311,084 (+) RGD Celera 16 48,861,616 - 48,893,051 (+) RGD
Sequence:
GGAGTCCCTCGTAGCGCCGCTTGCAGCTGGGAAGATGCTGGGCCGTAGTCTCCTCACCTGGGTCCTGGCCGCGGCTGTCACCTGCGCCCAGGCACAGCAAGTGCCACCGTGGACAGAAGATTGCAGAA
hide sequence
RefSeq Acc Id:
NP_445859 ⟸ NM_053407
- Peptide Label:
precursor
- UniProtKB:
Q9EQJ6 (UniProtKB/Swiss-Prot), Q6P7S1 (UniProtKB/Swiss-Prot), A0A8L2Q768 (UniProtKB/TrEMBL)
- Sequence:
MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIADVTGIPLGE
hide sequence
Ensembl Acc Id:
ENSRNOP00000074724 ⟸ ENSRNOT00000077188
Ensembl Acc Id:
ENSRNOP00000013463 ⟸ ENSRNOT00000013463
RGD ID: 13700117 Promoter ID: EPDNEW_R10638 Type: initiation region Name: Asah1_1 Description: N-acylsphingosine amidohydrolase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 53,998,576 - 53,998,636 EPDNEW
BioCyc Gene G2FUF-11260 BioCyc
Ensembl Genes ENSRNOG00000010034 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000013463.5 UniProtKB/TrEMBL
ENSRNOT00000077188.2 UniProtKB/TrEMBL
ENSRNOT00000154244 ENTREZGENE
Gene3D-CATH Penicillin V Acylase, Chain A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:6919949 IMAGE-MGC_LOAD
InterPro Acid_ceramidase-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Acid_ceramidase_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
CBAH/NAAA_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:84431 UniProtKB/Swiss-Prot
MGC_CLONE MGC:72746 IMAGE-MGC_LOAD
NCBI Gene 84431 ENTREZGENE
PANTHER ACID AMIDASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ACID CERAMIDASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam CBAH UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NAAA-beta UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Asah1 PhenoGen
PIRSF Acid_ceramidase-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000010034 RatGTEx
UniProt A0A0G2K8T0_RAT UniProtKB/TrEMBL
A0A8L2Q768 ENTREZGENE, UniProtKB/TrEMBL
A6JPT7_RAT UniProtKB/TrEMBL
ASAH1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q9EQJ6 ENTREZGENE
UniProt Secondary Q9EQJ6 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-29
Asah1
N-acylsphingosine amidohydrolase 1
Asah1
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Asah1
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Asah1
N-acylsphingosine amidohydrolase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Asah1
N-acylsphingosine amidohydrolase 1
Asah
N-acylsphingosine amidohydrolase (acid ceramidase)
Symbol and Name updated
1299863 APPROVED
2002-08-07
Asah
N-acylsphingosine amidohydrolase (acid ceramidase)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
deficiency of the human homolog causes Farber disease, a lipid storage disorder
634631
