Advanced Search (OLGA)

Gene: Glra3 (glycine receptor, alpha 3) Rattus norvegicus

Analyze

Symbol:

Glra3

Name:

glycine receptor, alpha 3

RGD ID:

621229

Description:

Enables extracellularly glycine-gated chloride channel activity. Involved in several processes, including cellular response to ethanol; cellular response to zinc ion; and chloride transmembrane transport. Located in plasma membrane. Is active in glycinergic synapse and postsynaptic specialization membrane. Orthologous to human GLRA3 (glycine receptor alpha 3); INTERACTS WITH 6-propyl-2-thiouracil; atrazine; bexarotene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glycine receptor subunit alpha-3; glycine receptor subunit alpha-3-like; glycine receptor, alpha 3 subunit; LOC100909864

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLRA3 (glycine receptor alpha 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Glra3 (glycine receptor, alpha 3 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Glra3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLRA3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLRA3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Glra3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLRA3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLRA3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Glra3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Glra3 (glycine receptor alpha 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MTF2 (metal response element binding transcription factor 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GLRA3 (glycine receptor alpha 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Glra3 (glycine receptor, alpha 3 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	glra3 (glycine receptor, alpha 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6927	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	avr-14	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GluClalpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GluClalpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	avr-15	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ggr-1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	glc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glc-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glc-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glc-4	Alliance	DIOPT (Hieranoid\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ort	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ort	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-39	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-41	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-51	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	lgc-52	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	lgc-55	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG12344	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	pHCl-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	lgc-42	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-58	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	glra3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	glra3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	39,210,534 - 39,857,332 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	39,210,536 - 39,856,764 (-)	Ensembl				GRCr8
mRatBN7.2	16	34,199,937 - 34,848,773 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	34,204,811 - 34,848,753 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	37,818,045 - 38,456,539 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	41,229,424 - 41,873,842 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	37,466,936 - 38,090,377 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	37,676,959 - 37,908,221 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	37,676,962 - 38,063,821 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	37,482,429 - 37,711,434 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	37,741,192 - 37,854,773 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	34,134,149 - 34,174,150 (-)	NCBI		Celera
RGSC_v3.1	16	37,741,266 - 37,850,505 (+)	NCBI
Cytogenetic Map	16	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ovarian carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

decabromodiphenyl ether (EXP)

epoxiconazole (ISO)

ethanol (EXP)

fipronil (ISO)

gamma-hexachlorocyclohexane (ISO)

ivermectin (ISO)

lead diacetate (EXP)

lead(0) (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methylmercury chloride (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

pirinixic acid (ISO)

prostaglandin E2 (ISO)

sodium arsenite (ISO)

tributylstannane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to amino acid stimulus (IDA)

cellular response to ethanol (IDA)

cellular response to zinc ion (IDA)

chloride transmembrane transport (IBA,IDA,IEA,ISO)

chloride transport (IEA)

excitatory postsynaptic potential (IEA)

glutamate receptor clustering (ISO)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

presynaptic modulation of chemical synaptic transmission (ISO)

protein homooligomerization (ISO)

Cellular Component

cell projection (IEA)

chloride channel complex (IEA)

dendrite (IEA,ISO)

GABA-ergic synapse (ISO)

glutamatergic synapse (ISO)

glycine-gated chloride channel complex (ISO,ISS)

glycinergic synapse (IDA,ISO)

membrane (IEA)

perikaryon (IEA)

plasma membrane (IDA,IEA,ISO,ISS)

postsynaptic membrane (IEA)

postsynaptic specialization membrane (IDA)

presynaptic membrane (ISO)

synapse (IEA)

Molecular Function

chloride channel activity (IBA,IEA)

excitatory extracellular ligand-gated monoatomic ion channel activity (IBA)

extracellular ligand-gated monoatomic ion channel activity (IEA)

extracellularly glycine-gated chloride channel activity (IDA,IEA,ISO)

glycine binding (IEA)

glycine-gated chloride ion channel activity (ISO,ISS)

metal ion binding (IEA)

monoatomic ion channel activity (IEA)

protein binding (ISO)

transmembrane signaling receptor activity (IEA)

transmitter-gated monoatomic ion channel activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Identification and functional expression of a novel ligand binding subunit of the inhibitory glycine receptor.	Kuhse J, etal., J Biol Chem 1990 Dec 25;265(36):22317-20.
4.	Zinc-dependent modulation of alpha2- and alpha3-glycine receptor subunits by ethanol.	McCracken LM, etal., Alcohol Clin Exp Res. 2013 Dec;37(12):2002-10. doi: 10.1111/acer.12192. Epub 2013 Jul 29.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9677400	PMID:15895087	PMID:19626554	PMID:19723286	PMID:20733588	PMID:22574341	PMID:23613537	PMID:26416729	PMID:26851771	PMID:27382060	PMID:38017313

Genomics

Comparative Map Data

Glra3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	39,210,534 - 39,857,332 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	39,210,536 - 39,856,764 (-)	Ensembl				GRCr8
mRatBN7.2	16	34,199,937 - 34,848,773 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	34,204,811 - 34,848,753 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	37,818,045 - 38,456,539 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	41,229,424 - 41,873,842 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	37,466,936 - 38,090,377 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	37,676,959 - 37,908,221 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	37,676,962 - 38,063,821 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	37,482,429 - 37,711,434 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	37,741,192 - 37,854,773 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	34,134,149 - 34,174,150 (-)	NCBI		Celera
RGSC_v3.1	16	37,741,266 - 37,850,505 (+)	NCBI
Cytogenetic Map	16	p11	NCBI

GLRA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	174,636,920 - 174,829,247 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	174,636,920 - 174,829,247 (-)	Ensembl			hg38	GRCh38
GRCh37	4	175,558,071 - 175,750,398 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	175,799,773 - 175,987,040 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	175,938,939 - 176,125,108	NCBI
Celera	4	172,892,194 - 173,079,664 (-)	NCBI		Celera
Cytogenetic Map	4	q34.1	NCBI
HuRef	4	171,312,700 - 171,499,685 (-)	NCBI		HuRef
CHM1_1	4	175,539,655 - 175,726,888 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	177,976,596 - 178,167,115 (-)	NCBI		T2T-CHM13v2.0

Glra3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	56,393,454 - 56,583,111 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	56,393,495 - 56,583,105 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	55,940,418 - 56,130,070 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	55,940,460 - 56,130,070 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	58,419,622 - 58,604,149 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	58,833,046 - 59,017,494 (+)	NCBI		MGSCv36	mm8
Celera	8	58,599,340 - 58,782,315 (+)	NCBI		Celera
Cytogenetic Map	8	B2	NCBI
cM Map	8	29.69	NCBI

Glra3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	32,304,178 - 32,445,135 (+)	Ensembl
ChiLan1.0	NW_004955403	32,304,178 - 32,445,135 (+)	NCBI	ChiLan1.0	ChiLan1.0

GLRA3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	172,396,653 - 172,579,346 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	172,777,048 - 172,959,364 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	166,865,061 - 167,045,844 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	179,103,608 - 179,279,618 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	179,083,211 - 179,279,232 (-)	Ensembl			panPan2	panpan1.1

GLRA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	25,098,280 - 25,305,511 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	25,131,250 - 25,305,027 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	25,783,206 - 25,957,841 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	25,261,937 - 25,469,138 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	25,294,466 - 25,469,586 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	25,195,872 - 25,403,554 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	25,098,834 - 25,305,712 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	25,250,704 - 25,458,008 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Glra3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	25,271,880 - 25,441,407 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936516	5,693,894 - 5,855,755 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936516	5,692,535 - 5,855,694 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GLRA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	15,423,767 - 15,595,422 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	15,120,091 - 15,603,509 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	16,573,210 - 16,788,071 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLRA3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	120,736,513 - 120,913,640 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	100,805,675 - 100,979,028 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Glra3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	6,291,924 - 6,444,131 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624769	6,274,213 - 6,444,553 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Glra3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	13	32,365,513 - 32,616,856 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Glra3
5246 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	54
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000075026
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	4354822	49354822	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	387123	45387123	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	387123	45387123	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4234212	49757901	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	36928782	81928782	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	28468701	73468701	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39568015	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39568015	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	32361043	77361043	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	31058039	76058039	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	34398294	79398294	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3386790	49757901	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	4744222	49744222	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	31885271	76885271	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17730818	72536785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	15905802	60905802	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	3301683	48301683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	sensory system	visual system
3	1	3	103	19	1	1	5	1	37	22	89	10	19	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ310838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M55250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075026 ⟹ ENSRNOP00000067536

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	39,215,029 - 39,856,764 (-)	Ensembl
mRatBN7.2 Ensembl	16	34,204,811 - 34,848,753 (-)	Ensembl
Rnor_6.0 Ensembl	16	37,676,962 - 37,908,173 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077452 ⟹ ENSRNOP00000069714

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	37,676,962 - 38,063,821 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089533 ⟹ ENSRNOP00000071732

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	37,676,962 - 38,063,821 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167098 ⟹ ENSRNOP00000105054

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	39,210,536 - 39,856,764 (-)	Ensembl

RefSeq Acc Id:

NM_053724 ⟹ NP_446176

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	39,210,536 - 39,857,006 (-)	NCBI
mRatBN7.2	16	34,199,937 - 34,848,773 (-)	NCBI
Rnor_6.0	16	37,676,959 - 37,908,221 (-)	NCBI
Rnor_5.0	16	37,482,429 - 37,711,434 (-)	NCBI
RGSC_v3.4	16	37,741,192 - 37,854,773 (+)	RGD
Celera	16	34,134,149 - 34,174,150 (-)	RGD

Sequence:

show sequence

ATGCCTTGGATAAGACTGTTTTCAGGATCGGGAATATCTTTCCGTATCATGGCCCACGTGAGAC
ACTTTCGGACACTACTTTCTGGATTTTACTTCTGGGAAGCCGCACTGTTACTGAGTTTGGTGGC
CACGAAGGAAACAAACAGTGCACGGTCCCGAAGTGCCCCAATGTCACCTTCTGATTTTCTGGAC
AAACTAATGGGGAGGACATCCGGGTATGATGCAAGAATCAGGCCCAACTTCAAAGGTCCTCCAG
TTAATGTCACATGCAACATATTCATAAACAGCTTTGGCTCCATCGCAGAGACGACTATGGATTA
CAGAGTAAACATTTTCCTTCGTCAGAAGTGGAATGATCCTCGCCTTGCATACAGTGAATACCCT
GATGATTCATTAGACCTCGACCCATCCATGTTGGACTCCATATGGAAACCTGACTTGTTCTTTG
CTAATGAGAAGGGGGCTAACTTCCACGAAGTCACCACCGATAACAAGCTGCTAAGAATTTTCAA
AAATGGAAATGTTCTTTATTCAATAAGGCTGACATTAACACTCTCTTGTCCAATGGATCTCAAG
AATTTCCCAATGGATGTTCAAACATGCATAATGCAACTCGAAAGCTTTGGGTACACGATGAATG
ATCTCATTTTCGAATGGCAAGATGAAGCACCAGTACAAGTGGCTGAAGGACTCACTTTGCCTCA
ATTTCTGTTGAAAGAAGAAAAAGATTTGCGATACTGCACTAAACACTACAATACAGGAAAGTTT
ACATGCATAGAAGTACGATTTCATCTTGAGCGGCAAATGGGCTACTACTTGATCCAGATGTACA
TTCCCAGCCTTCTGATTGTCATTCTGTCCTGGGTCTCATTCTGGATTAACATGGATGCAGCTCC
GGCTCGGGTAGCGTTGGGTATCACCACTGTACTTACGATGACCACGCAGAGTTCTGGATCCCGG
GCTTCTTTACCAAAGGTGTCCTATGTCAAGGCAATTGACATTTGGATGGCAGTGTGTCTCCTTT
TTGTGTTCTCAGCACTTCTGGAGTATGCAGCCGTGAATTTTGTATCAAGGCAACACAAAGAACT
GCTGAGGTTTCGGCGAAAGAGGAAAAATAAAACAGAAGCTTTTGCACTGGAGAAGTTTTACCGT
TTCTCAGACACGGATGATGAGGTGAGGGAGAGTCGGTTCAGCTTCACTGCCTATGGAATGGGGC
CCTGTCTTCAAGCAAAGGATGGTGTGGTTCCAAAAGGTCCCAACCATGCTGTCCAGGTCATGCC
AAAGAGCGCCGATGAAATGAGGAAGGTCTTCATCGACAGGGCTAAGAAGATCGACACCATCTCC
CGAGCCTGCTTTCCGCTAGCATTTCTGATTTTTAACATTTTCTACTGGGTTATCTATAAAATCC
TTAGGCATGAAGACATTCATCATCAGCAAGATTAA

hide sequence

RefSeq Acc Id:

XM_063274983 ⟹ XP_063131053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	39,210,534 - 39,857,332 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446176	(Get FASTA)	NCBI Sequence Viewer
	XP_063131053	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA63492	(Get FASTA)	NCBI Sequence Viewer
	CAC35982	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067536
	ENSRNOP00000105054
GenBank Protein	P24524	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446176 ⟸ NM_053724
- Peptide Label:	precursor
- UniProtKB:	P24524 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MPWIRLFSGSGISFRIMAHVRHFRTLLSGFYFWEAALLLSLVATKETNSARSRSAPMSPSDFLD KLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLK NFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSR ASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKFYR FSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSADEMRKVFIDRAKKIDTIS RACFPLAFLIFNIFYWVIYKILRHEDIHHQQD hide sequence

Ensembl Acc Id:

ENSRNOP00000071732 ⟸ ENSRNOT00000089533

Ensembl Acc Id:

ENSRNOP00000067536 ⟸ ENSRNOT00000075026

Ensembl Acc Id:

ENSRNOP00000069714 ⟸ ENSRNOT00000077452

RefSeq Acc Id:	XP_063131053 ⟸ XM_063274983
- Peptide Label:	isoform X1
- UniProtKB:	M0RD42 (UniProtKB/TrEMBL), Q99JC9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105054 ⟸ ENSRNOT00000167098

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24524-F1-model_v2	AlphaFold	P24524	1-464	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621229	AgrOrtholog
BioCyc Gene	G2FUF-11511	BioCyc
Ensembl Genes	ENSRNOG00000049792	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000075026	ENTREZGENE
	ENSRNOT00000167098	ENTREZGENE
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	GABAA/Glycine_rcpt	UniProtKB/Swiss-Prot
	Glycine_rcpt_A	UniProtKB/Swiss-Prot
	Glycine_rcpt_A3	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
NCBI Gene	114516	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Glra3	PhenoGen
PRINTS	GABAARECEPTR	UniProtKB/Swiss-Prot
	GLYRALPHA	UniProtKB/Swiss-Prot
	GLYRALPHA3	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000049792	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
UniProt	A0ABZ3NN48_RAT	UniProtKB/TrEMBL
	GLRA3_RAT	UniProtKB/Swiss-Prot
	M0RD42	ENTREZGENE
	P24524	ENTREZGENE
	Q99JC9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Glra3	glycine receptor, alpha 3	LOC100909864	glycine receptor subunit alpha-3-like	Data merged from RGD:6501221	737654	PROVISIONAL
2012-07-05	LOC100909864	glycine receptor subunit alpha-3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-10-16	Glra3	glycine receptor, alpha 3	Glra3	glycine receptor, alpha 3 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Glra3	glycine receptor, alpha 3 subunit		glycine receptor, alpha 3	Name updated	1299863	APPROVED
2002-08-07	Glra3	glycine receptor, alpha 3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	enriched in spinal cord at later postnatal stages of development	728440

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD