Advanced Search (OLGA)

Gene: Acmsd (aminocarboxymuconate semialdehyde decarboxylase) Rattus norvegicus

Analyze

Symbol:

Acmsd

Name:

aminocarboxymuconate semialdehyde decarboxylase

RGD ID:

620868

Description:

Enables aminocarboxymuconate-semialdehyde decarboxylase activity. Involved in L-tryptophan catabolic process. Predicted to be active in cytosol. Used to study kidney failure. Orthologous to human ACMSD (aminocarboxymuconate semialdehyde decarboxylase); PARTICIPATES IN kynurenine metabolic pathway; tryptophan metabolic pathway; INTERACTS WITH (+)-schisandrin B; 1-nitropropane; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	41,752,894 - 41,798,427 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	41,752,875 - 41,798,427 (+)	Ensembl				GRCr8
mRatBN7.2	13	39,200,412 - 39,245,954 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	39,200,314 - 39,245,209 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	41,786,679 - 41,829,829 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	43,074,766 - 43,117,920 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	40,337,153 - 40,381,033 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	44,424,689 - 44,468,734 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	44,424,689 - 44,468,734 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	49,510,444 - 49,553,512 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	40,547,366 - 40,573,698 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	39,577,658 - 39,620,559 (+)	NCBI		Celera
RGSC_v3.1	13	40,561,408 - 40,587,743 (-)	NCBI
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Diabetes Mellitus (IDA,IEP)

kidney failure (IDA)

Puromycin Aminonucleoside Nephrosis (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-nitropropane (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (EXP)

2,6-diaminotoluene (EXP)

2-acetamidofluorene (EXP)

2-nitro-p-phenylenediamine (EXP)

2-nitropropane (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-acetylaminofluorene (EXP)

4-nitro-1,2-phenylenediamine (EXP)

acetamide (EXP)

acrylamide (EXP)

adenine (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlorpyrifos (EXP)

clofibric acid (EXP)

cyclosporin A (ISO)

diazinon (EXP)

dibutyl phthalate (EXP)

eugenol (EXP)

furan (EXP,ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

kojic acid (ISO)

linoleic acid (EXP)

metformin (EXP)

N-methyl-6-pyridone-3-carboxamide (ISO)

N-nitrosodiethylamine (EXP)

NAD zwitterion (EXP)

NAD(+) (EXP)

nicotinic acid (EXP,ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

paracetamol (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

PhIP (EXP)

pirinixic acid (EXP,ISO)

propanal (ISO)

pyrazine-2-carboxylic acid (EXP)

quinolinic acid (EXP)

resveratrol (EXP)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

Tesaglitazar (EXP)

tetrachloromethane (EXP)

trichloroethene (ISO)

triptonide (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

L-tryptophan catabolic process (IDA,IEA)

negative regulation of quinolinate biosynthetic process (IEA,ISO,ISS)

secondary metabolic process (IBA)

Cellular Component

cytoplasm (IBA,IEA)

cytosol (IBA,IEA,ISO,ISS,TAS)

Molecular Function

aminocarboxymuconate-semialdehyde decarboxylase activity (IDA,IEA,ISO,ISS)

carboxy-lyase activity (IEA)

hydrolase activity (IEA)

lyase activity (IEA)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

kynurenine metabolic pathway (ISO)

tryptophan metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The effect of age on the enzyme activities of tryptophan metabolism along the kynurenine pathway in rats.	Comai S, etal., Clin Chim Acta. 2005 Oct;360(1-2):67-80. doi: 10.1016/j.cccn.2005.04.013.
2.	Tryptophan-niacin metabolism in rat with puromycin aminonucleoside-induced nephrosis.	Egashira Y, etal., Int J Vitam Nutr Res. 2006 Jan;76(1):28-33. doi: 10.1024/0300-9831.76.1.28.
3.	Identification and expression of a cDNA encoding human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase (ACMSD). A key enzyme for the tryptophan-niacine pathway and "quinolinate hypothesis".	Fukuoka S, etal., J Biol Chem 2002 Sep 20;277(38):35162-7.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	The kynurenine pathway and neurodegenerative disease.	Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Mechanism of increases in L-kynurenine and quinolinic acid in renal insufficiency.	Saito K, etal., Am J Physiol Renal Physiol. 2000 Sep;279(3):F565-72. doi: 10.1152/ajprenal.2000.279.3.F565.
15.	Production of L-tryptophan-derived catabolites in hepatocytes from streptozotocin-induced diabetic rats.	Sasaki N, etal., Eur J Nutr. 2009 Apr;48(3):145-53. doi: 10.1007/s00394-009-0774-7. Epub 2009 Jan 23.
16.	Purification and molecular cloning of rat 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase.	Tanabe A, etal., Biochem J 2002 Feb 1;361(Pt 3):567-75.
17.	Expression of rat hepatic 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase is affected by a high protein diet and by streptozotocin-induced diabetes.	Tanabe A, etal., J Nutr. 2002 Jun;132(6):1153-9. doi: 10.1093/jn/132.6.1153.

Additional References at PubMed

PMID:17288562	PMID:19843166	PMID:23376485	PMID:25289390	PMID:25392945

Genomics

Comparative Map Data

Acmsd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	41,752,894 - 41,798,427 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	41,752,875 - 41,798,427 (+)	Ensembl				GRCr8
mRatBN7.2	13	39,200,412 - 39,245,954 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	39,200,314 - 39,245,209 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	41,786,679 - 41,829,829 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	43,074,766 - 43,117,920 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	40,337,153 - 40,381,033 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	44,424,689 - 44,468,734 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	44,424,689 - 44,468,734 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	49,510,444 - 49,553,512 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	40,547,366 - 40,573,698 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	39,577,658 - 39,620,559 (+)	NCBI		Celera
RGSC_v3.1	13	40,561,408 - 40,587,743 (-)	NCBI
Cytogenetic Map	13	q13	NCBI

ACMSD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	134,838,616 - 134,902,034 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	134,838,312 - 134,902,906 (+)	Ensembl			hg38	GRCh38
GRCh37	2	135,596,186 - 135,659,604 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	135,312,656 - 135,376,074 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	135,429,919 - 135,493,332	NCBI
Celera	2	129,309,109 - 129,372,527 (+)	NCBI		Celera
Cytogenetic Map	2	q21.3	NCBI
HuRef	2	127,587,573 - 127,651,049 (+)	NCBI		HuRef
CHM1_1	2	135,600,992 - 135,664,414 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	135,278,873 - 135,342,322 (+)	NCBI		T2T-CHM13v2.0

Acmsd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	127,657,149 - 127,695,723 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	127,657,150 - 127,695,715 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	127,729,413 - 127,767,564 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	127,729,413 - 127,767,978 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	129,625,990 - 129,664,141 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	129,556,959 - 129,595,110 (+)	NCBI		MGSCv36	mm8
Celera	1	130,370,820 - 130,409,013 (+)	NCBI		Celera
Cytogenetic Map	1	E3	NCBI
cM Map	1	55.8	NCBI

Acmsd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955440	2,348,396 - 2,412,706 (+)	Ensembl
ChiLan1.0	NW_004955440	2,348,434 - 2,412,706 (+)	NCBI	ChiLan1.0	ChiLan1.0

ACMSD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	40,027,693 - 40,088,834 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	40,042,663 - 40,102,757 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	24,958,661 - 25,019,901 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	138,918,281 - 138,978,407 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	138,918,281 - 138,978,407 (+)	Ensembl			panPan2	panpan1.1

ACMSD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	37,658,999 - 37,725,426 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	37,659,226 - 37,725,172 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	37,899,088 - 37,966,088 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	39,104,331 - 39,171,370 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	39,104,336 - 39,171,359 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	37,746,853 - 37,813,851 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	37,907,821 - 37,974,822 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	39,142,980 - 39,209,976 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Acmsd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	100,712,913 - 100,760,168 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	40,858,338 - 40,904,807 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	40,858,338 - 40,904,807 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACMSD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	17,106,724 - 17,163,899 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	17,121,950 - 17,164,005 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	19,522,142 - 19,538,454 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACMSD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	19,063,731 - 19,128,387 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	19,064,115 - 19,129,089 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666061	3,375,719 - 3,440,136 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acmsd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	34,232,908 - 34,292,898 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624732	34,232,890 - 34,294,195 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Acmsd
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	7,945,664 - 7,993,702 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Acmsd
332 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	18
Count of miRNA genes:	17
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000005206
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	12448421	47969993	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2303030	Bp327	Blood pressure QTL 327			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	43736554	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	6002008	47359539	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	3088755	48088755	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
4	9	28	45	63	70	40	35	40	4	210	80	4	33	79	59	30	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB069781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005206 ⟹ ENSRNOP00000005206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	41,752,968 - 41,798,427 (+)	Ensembl
mRatBN7.2 Ensembl	13	39,200,486 - 39,245,209 (+)	Ensembl
Rnor_6.0 Ensembl	13	44,424,689 - 44,468,734 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097274 ⟹ ENSRNOP00000079363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	41,752,875 - 41,798,408 (+)	Ensembl
mRatBN7.2 Ensembl	13	39,200,314 - 39,245,209 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109111 ⟹ ENSRNOP00000081182

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	41,752,875 - 41,798,408 (+)	Ensembl
mRatBN7.2 Ensembl	13	39,200,314 - 39,245,209 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119830 ⟹ ENSRNOP00000088596

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	39,200,314 - 39,245,209 (+)	Ensembl

RefSeq Acc Id:

NM_134372 ⟹ NP_599199

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	41,752,894 - 41,798,427 (+)	NCBI
mRatBN7.2	13	39,200,412 - 39,245,954 (+)	NCBI
Rnor_6.0	13	44,424,689 - 44,468,734 (+)	NCBI
Rnor_5.0	13	49,510,444 - 49,553,512 (+)	NCBI
RGSC_v3.4	13	40,547,366 - 40,573,698 (-)	RGD
Celera	13	39,577,658 - 39,620,559 (+)	RGD

Sequence:

show sequence

ATGAAAATTGACATCCACACTCACATTCTACCAAAGGAATGGCCTGATCTAGAAAAGAGGTTTG
GCTATGGAGGCTGGGTGCAGCTCCAACAGCAAGGCAAGGGAGAAGCAAAGATGATGAAAGACGG
GAAGGTCTTCAGAGTGATCCAACAGAACTGCTGGGACCCAGAAGTCCGCATCAGAGAAATGAAC
CAGAAAGGAGTGACAGTGCAAGCTCTTTCCACAGTTCCCGTCATGTTTAGTTACTGGGCCAAAC
CTAAGGACACTTTGGAACTGTGCCAGTTTTTAAACAATGACCTCGCTGCCACGGTGGCCAGATA
CCCTCGAAGGTTTGTGGGTTTGGGGACATTGCCTATGCAAGCCCCGGGGCTGGCTGTCGAGGAG
ATGGAGCGTTGTGTAAAGGAGCTAGGATTTCCAGGAATCCAGATTGGATCCCACATCAACATGT
GGGACCTGAATGACCCGGAACTCTTCCCCATCTACACGGCGGCTGAGAGGCTGAATTGTTCTCT
GTTCGTGCATCCCTGGGATATGCAGATGGATGGACGGATGGCCAAATACTGGCTGCCTTGGCTC
GTAGGAATGCCATCGGAGACCACCACGGCCATTTGCTCCATGATCATGGGTGGGGTGTTCGAGA
AGTTTCCCAAACTCAAAGTGTGTTTTGCACATGGAGGTGGTGCTTTCCCCTTCACCATAGGAAG
AATTGCTCATGGATTTAACATGCGCCCAGATCTCTGTGCCCGGGACAATTCATCTGACCCCAGA
AAATACCTTGGCTCCTTCTACACGGACTCCCTGGTTCATGATCCTCTGTCTCTCAAGCTATTGA
CAGATGTTATAGGGAAGGATAGAGTTATTCTGGGAACTGATTACCCCTTTCCACTAGGTGAGCA
GGAGCCTGGGAAGTTGATAGAGTCTATGGCAGACTTTGATGAAGAAACAAAGGATAAACTTACA
GCTGGCAATGCCTTGACTTTTTTGGGTCTTGAGAGAAAACTATTTGAATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599199	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB84692	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081182
	ENSRNOP00000081182.1
GenBank Protein	Q8R5M5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599199 ⟸ NM_134372

- UniProtKB:

Q8R5M5 (UniProtKB/Swiss-Prot), A6IBV8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKIDIHTHILPKEWPDLEKRFGYGGWVQLQQQGKGEAKMMKDGKVFRVIQQNCWDPEVRIREMN
QKGVTVQALSTVPVMFSYWAKPKDTLELCQFLNNDLAATVARYPRRFVGLGTLPMQAPGLAVEE
MERCVKELGFPGIQIGSHINMWDLNDPELFPIYTAAERLNCSLFVHPWDMQMDGRMAKYWLPWL
VGMPSETTTAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTIGRIAHGFNMRPDLCARDNSSDPR
KYLGSFYTDSLVHDPLSLKLLTDVIGKDRVILGTDYPFPLGEQEPGKLIESMADFDEETKDKLT
AGNALTFLGLERKLFE

hide sequence

Ensembl Acc Id:

ENSRNOP00000005206 ⟸ ENSRNOT00000005206

Ensembl Acc Id:

ENSRNOP00000081182 ⟸ ENSRNOT00000109111

Ensembl Acc Id:

ENSRNOP00000088596 ⟸ ENSRNOT00000119830

Ensembl Acc Id:

ENSRNOP00000079363 ⟸ ENSRNOT00000097274

Protein Domains

Amidohydrolase-related

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R5M5-F1-model_v2	AlphaFold	Q8R5M5	1-336	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698775

Promoter ID:

EPDNEW_R9300

Type:

multiple initiation site

Name:

Acmsd_1

Description:

aminocarboxymuconate semialdehyde decarboxylase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	44,424,615 - 44,424,675	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620868	AgrOrtholog
BioCyc Gene	G2FUF-18436	BioCyc
BioCyc Pathway	PWY-5652 [2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA]	BioCyc
BioCyc Pathway Image	PWY-5652	BioCyc
Ensembl Genes	ENSRNOG00000003884	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000109111	ENTREZGENE
	ENSRNOT00000109111.1	UniProtKB/Swiss-Prot
Gene3D-CATH	Metal-dependent hydrolases	UniProtKB/Swiss-Prot
InterPro	ACMSD/PatG/YanB	UniProtKB/Swiss-Prot
	Amidohydro-rel	UniProtKB/Swiss-Prot
	Metal_Hydrolase	UniProtKB/Swiss-Prot
KEGG Report	rno:171385	UniProtKB/Swiss-Prot
NCBI Gene	171385	ENTREZGENE
PANTHER	2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOXYLASE	UniProtKB/Swiss-Prot
	PTHR21240	UniProtKB/Swiss-Prot
Pfam	Amidohydro_2	UniProtKB/Swiss-Prot
PhenoGen	Acmsd	PhenoGen
RatGTEx	ENSRNOG00000003884	RatGTEx
Superfamily-SCOP	SSF51556	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZMP7_RAT	UniProtKB/TrEMBL
	A6IBV8	ENTREZGENE, UniProtKB/TrEMBL
	A9CMA9_RAT	UniProtKB/TrEMBL
	ACMSD_RAT	UniProtKB/Swiss-Prot
	F8WFI2_RAT	UniProtKB/TrEMBL
	Q8R5M5	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Acmsd	aminocarboxymuconate semialdehyde decarboxylase	Acmsd	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Acmsd	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	acmsd	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	involved in diabetes	70243
gene_expression	expressed in liver and kidney only	70243
gene_function	converts 2-amino-3-carboxymuconate-6-semialdehyde to 2-aminomuconate-6-semialdehyde	70243
gene_process	may function in tryptophan-niacin metabolism	70243

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways