Advanced Search (OLGA)

Gene: Eif2b2 (eukaryotic translation initiation factor 2B subunit beta) Rattus norvegicus

Analyze

Symbol:

Eif2b2

Name:

eukaryotic translation initiation factor 2B subunit beta

RGD ID:

620820

Description:

Contributes to guanyl-nucleotide exchange factor activity. Involved in several processes, including hippocampus development; positive regulation of axon extension; and response to glucose. Located in axon. Part of eukaryotic translation initiation factor 2B complex. Is active in endoplasmic reticulum; glycinergic synapse; and postsynapse. Human ortholog(s) of this gene implicated in leukoencephalopathy with vanishing white matter and leukoencephalopathy with vanishing white matter 2. Orthologous to human EIF2B2 (eukaryotic translation initiation factor 2B subunit beta); PARTICIPATES IN translation initiation pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

eIF-2B GDP-GTP exchange factor subunit beta; eIF2B GDP-GTP exchange factor subunit beta; eukaryotic translation initiation factor 2B subunit 2; eukaryotic translation initiation factor 2B, subunit 2 (beta, 39kD); eukaryotic translation initiation factor 2B, subunit 2 beta; translation initiation factor eIF-2B subunit beta; translation initiation factor eIF2B subunit beta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	110,597,979 - 110,604,403 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	110,597,729 - 110,604,403 (+)	Ensembl				GRCr8
mRatBN7.2	6	104,866,926 - 104,873,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	104,866,753 - 104,873,353 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,036,549 - 105,042,974 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,335,420 - 105,341,845 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	104,705,081 - 104,711,507 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,044,830 - 109,051,254 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,043,880 - 109,051,253 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	116,505,786 - 116,512,210 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,266,354 - 109,272,778 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	102,689,874 - 102,696,298 (+)	NCBI		Celera
RGSC_v3.1	6	109,269,805 - 109,276,234 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Leukoencephalopathies (ISO)

leukoencephalopathy with vanishing white matter (ISO)

leukoencephalopathy with vanishing white matter 1 (ISO)

leukoencephalopathy with vanishing white matter 2 (ISO)

leukoencephalopathy with vanishing white matter 5 (ISO)

Lynch syndrome (ISO)

Nervous System Malformations (ISO)

osteogenesis imperfecta (ISO)

premature menopause (ISO)

primary ovarian insufficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

Butylbenzyl phthalate (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

clobetasol (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

ozone (EXP)

paracetamol (ISO)

pirinixic acid (EXP)

quercetin (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IEA)

central nervous system development (IEA,ISO,ISS)

cytoplasmic translational initiation (IEA,ISO,ISS)

hippocampus development (IEP)

myelination (IEA,ISO,ISS)

oligodendrocyte development (IEA,ISO,ISS)

ovarian follicle development (IEA,ISO,ISS)

positive regulation of axon extension (IMP)

positive regulation of translational initiation (IEA,ISO)

response to glucose (IDA)

response to heat (IDA)

response to peptide hormone (IDA)

T cell receptor signaling pathway (IEA,ISO,ISS)

translation (IEA)

translational initiation (IBA,IEA,ISO,ISS)

Cellular Component

axon (IDA)

cytoplasm (IEA,ISO,ISS)

cytosol (IEA)

endoplasmic reticulum (IDA)

eukaryotic translation initiation factor 2B complex (IBA,IDA,IEA,ISO,ISS)

glycinergic synapse (IDA)

postsynapse (IDA)

Molecular Function

ATP binding (IEA,ISO,ISS)

GTP binding (IEA,ISO,ISS)

guanyl-nucleotide exchange factor activity (IBA,IDA,IEA,ISO,ISS)

protein binding (ISO)

translation initiation factor activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA transport pathway (IEA)

translation initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of domains within the epsilon-subunit of the translation initiation factor eIF2B that are necessary for guanine nucleotide exchange activity and eIF2B holoprotein formation.	Anthony TG, etal., Biochim Biophys Acta. 2000 Jun 21;1492(1):56-62.
2.	Subunit assembly and guanine nucleotide exchange activity of eukaryotic initiation factor-2B expressed in Sf9 cells.	Fabian JR, etal., J Biol Chem. 1997 May 9;272(19):12359-65.
3.	Reconstitution and purification of eukaryotic initiation factor 2B (eIF2B) expressed in Sf21 insect cells.	Fabian JR, etal., Protein Expr Purif. 1998 Jun;13(1):16-22.
4.	Dendritic and postsynaptic protein synthetic machinery.	Gardiol A, etal., J Neurosci. 1999 Jan 1;19(1):168-79.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Glucose stimulates the activity of the guanine nucleotide-exchange factor eIF-2B in isolated rat islets of Langerhans.	Gilligan M, etal., J Biol Chem. 1996 Jan 26;271(4):2121-5.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	The mechanism of eukaryotic translation initiation: new insights and challenges.	Hinnebusch AG and Lorsch JR, Cold Spring Harb Perspect Biol. 2012 Oct 1;4(10). pii: a011544. doi: 10.1101/cshperspect.a011544.
9.	Developmental changes of eukaryotic initiation factor 2B subunits in rat hippocampus.	Inamura N, etal., Neurosci Lett. 2003 Jul 31;346(1-2):117-9.
10.	Intra-axonal synthesis of eukaryotic translation initiation factors regulates local protein synthesis and axon growth in rat sympathetic neurons.	Kar AN, etal., J Neurosci. 2013 Apr 24;33(17):7165-74. doi: 10.1523/JNEUROSCI.2040-12.2013.
11.	Regulation of eukaryotic initiation factor-2B activity in muscle of diabetic rats.	Karinch AM, etal., Am J Physiol. 1993 Jan;264(1 Pt 1):E101-8.
12.	Expression, purification, and crystallization of Schizosaccharomyces pombe eIF2B.	Kashiwagi K, etal., J Struct Funct Genomics. 2016 Mar;17(1):33-8. doi: 10.1007/s10969-016-9203-3. Epub 2016 Mar 29.
13.	Regulation of guanine nucleotide exchange through phosphorylation of eukaryotic initiation factor eIF2alpha. Role of the alpha- and delta-subunits of eiF2b.	Kimball SR, etal., J Biol Chem. 1998 May 22;273(21):12841-5.
14.	Subunits of the translation initiation factor eIF2B are mutant in leukoencephalopathy with vanishing white matter.	Leegwater PA, etal., Nat Genet 2001 Dec;29(4):383-8.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	eIF2B, the guanine nucleotide-exchange factor for eukaryotic initiation factor 2. Sequence conservation between the alpha, beta and delta subunits of eIF2B from mammals and yeast.	Price NT, etal., Biochem J 1996 Sep 1;318 ( Pt 2):637-43.
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Comprehensive gene review and curation	RGD comprehensive gene curation
23.	Inactivation of eIF2B and phosphorylation of PHAS-I in heat-shocked rat hepatoma cells.	Scheper GC, etal., J Biol Chem. 1997 Oct 24;272(43):26850-6.
24.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8626696	PMID:11323413	PMID:14566705	PMID:15054402	PMID:15060152	PMID:15217090	PMID:15507143	PMID:15776425	PMID:16289705

Genomics

Comparative Map Data

Eif2b2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	110,597,979 - 110,604,403 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	110,597,729 - 110,604,403 (+)	Ensembl				GRCr8
mRatBN7.2	6	104,866,926 - 104,873,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	104,866,753 - 104,873,353 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,036,549 - 105,042,974 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,335,420 - 105,341,845 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	104,705,081 - 104,711,507 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,044,830 - 109,051,254 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,043,880 - 109,051,253 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	116,505,786 - 116,512,210 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,266,354 - 109,272,778 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	102,689,874 - 102,696,298 (+)	NCBI		Celera
RGSC_v3.1	6	109,269,805 - 109,276,234 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

EIF2B2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	75,002,921 - 75,012,366 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	75,002,894 - 75,012,366 (+)	Ensembl			hg38	GRCh38
GRCh37	14	75,469,624 - 75,479,069 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	74,539,365 - 74,546,045 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	74,539,400 - 74,546,045	NCBI
Celera	14	55,507,321 - 55,513,985 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	55,637,467 - 55,644,134 (+)	NCBI		HuRef
CHM1_1	14	75,408,166 - 75,414,844 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	69,212,006 - 69,221,436 (+)	NCBI		T2T-CHM13v2.0

Eif2b2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	85,266,255 - 85,273,402 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	85,266,255 - 85,273,402 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	85,219,481 - 85,226,628 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	85,219,481 - 85,226,628 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	86,560,463 - 86,567,578 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	86,108,616 - 86,115,731 (+)	NCBI		MGSCv36	mm8
Celera	12	86,677,163 - 86,684,278 (+)	NCBI		Celera
Cytogenetic Map	12	D1	NCBI
cM Map	12	39.6	NCBI

Eif2b2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955523	553,356 - 559,376 (-)	Ensembl
ChiLan1.0	NW_004955523	553,356 - 559,376 (-)	NCBI	ChiLan1.0	ChiLan1.0

EIF2B2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	76,083,418 - 76,091,858 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	75,299,983 - 75,308,362 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	55,554,516 - 55,561,201 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	74,399,056 - 74,405,770 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	74,399,056 - 74,405,770 (+)	Ensembl			panPan2	panpan1.1

EIF2B2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	48,110,521 - 48,117,175 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	48,110,050 - 48,116,686 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	47,794,633 - 47,801,288 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	48,338,118 - 48,344,788 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	48,338,090 - 48,346,938 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	48,008,933 - 48,015,589 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	48,030,425 - 48,037,077 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	48,428,882 - 48,435,552 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eif2b2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	27,907,242 - 27,918,497 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	4,150,460 - 4,156,480 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	4,150,504 - 4,156,483 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF2B2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	98,203,815 - 98,224,462 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	98,203,820 - 98,246,199 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	104,047,924 - 104,054,506 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF2B2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	52,217,390 - 52,224,045 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	52,217,365 - 52,227,930 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	40,447,520 - 40,454,221 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif2b2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	26,682,521 - 26,688,559 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	26,682,521 - 26,688,490 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eif2b2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	99,327,579 - 99,334,668 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Eif2b2
38 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	69
Count of miRNA genes:	64
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000008730
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat

Markers in Region

RH143129

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,867,643 - 104,867,819 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,045,548 - 109,045,723	NCBI	Rnor6.0
Rnor_5.0	6	116,511,317 - 116,511,492	UniSTS	Rnor5.0
RGSC_v3.4	6	109,267,072 - 109,267,247	UniSTS	RGSC3.4
Celera	6	102,690,592 - 102,690,767	UniSTS
RH 3.4 Map	6	742.4	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH129431

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,873,100 - 104,873,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,051,004 - 109,051,208	NCBI	Rnor6.0
Rnor_5.0	6	116,505,832 - 116,506,036	UniSTS	Rnor5.0
RGSC_v3.4	6	109,272,528 - 109,272,732	UniSTS	RGSC3.4
Celera	6	102,696,048 - 102,696,252	UniSTS
Cytogenetic Map	6	q31	UniSTS

RH139101

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	104,867,627 - 104,867,792 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,045,532 - 109,045,696	NCBI	Rnor6.0
Rnor_5.0	6	116,511,344 - 116,511,508	UniSTS	Rnor5.0
RGSC_v3.4	6	109,267,056 - 109,267,220	UniSTS	RGSC3.4
Celera	6	102,690,576 - 102,690,740	UniSTS
Cytogenetic Map	6	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_032058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC114701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U31880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U83914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008730 ⟹ ENSRNOP00000008730

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	110,597,729 - 110,604,403 (+)	Ensembl
mRatBN7.2 Ensembl	6	104,866,753 - 104,873,351 (+)	Ensembl
Rnor_6.0 Ensembl	6	109,043,880 - 109,051,253 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107973 ⟹ ENSRNOP00000086822

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	110,597,729 - 110,604,403 (+)	Ensembl
mRatBN7.2 Ensembl	6	104,866,753 - 104,873,353 (+)	Ensembl

RefSeq Acc Id:

NM_032058 ⟹ NP_114447

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	110,597,979 - 110,604,403 (+)	NCBI
mRatBN7.2	6	104,866,926 - 104,873,351 (+)	NCBI
Rnor_6.0	6	109,044,830 - 109,051,254 (+)	NCBI
Rnor_5.0	6	116,505,786 - 116,512,210 (-)	NCBI
RGSC_v3.4	6	109,266,354 - 109,272,778 (+)	RGD
Celera	6	102,689,874 - 102,696,298 (+)	RGD

Sequence:

show sequence

CTGGCAGTTGAGGCTTCTGCAAGTCCAGGGACTGTAGTGGAGATGCCGGGTGCCGCGGCGAAGG
GCTCGGAGTTGTCCGAGAGGATCGAGAGCTTCGTGGAAACTCTGAAGCGAGGTGGCGGGCGGCG
CAGCTCGGAGGACATGGCTCGGGAGACCCTGGGGCTGCTGCGCCGGCTCATCACGGACCACCAC
TGGAACAACGCCGGGGACCTAATGGATTTGATCCGCAGAGAGGGTAGGAGGATGACAGCCGCGC
AGCCCTCCGAGACCACCGTGGGAAACATGGTGCGGAGAGTCCTCAAGATCATACGGGAGGAGTA
TGGCAGACTGCATGGGCGCAGTGATGAGAGCGATCAGCAGGAGTCCCTGCACAAACTCTTGACA
TCCGGAGGCCTGAGCGAGGATTTCAGCTTCCATTATGCCCCACTTAAGTCCAACATCATTGAGG
CGATTAATGAGCTGCTAGTGGAACTGGAAGGCACAACGGAGAACATTGCAGCCCAAGCTCTGGA
GCACATCCACTCCAACGAGGTGATCATGACCATTGGCTTCTCTAGGACAGTCGAGGCTTTCCTT
AGAGAGGCAGCCCAGAAGAGGAAGTTCCATGTCATTGCTGCAGAGTGTGCTCCTTTCTGCCAGG
GACATGAAATGGCCGTCAATTTGTCCGAAGCAGGTATCGAGACAACTGTCATGACCGATGCTGC
CATTTTTGCTGTTATGTCAAGAGTCAACAAGGTGATCATTGGTACGAAGACTATCCTGGCCAAT
GGTTCCCTGAGGGCTGTGGCAGGAACTCACACTCTGGCACTGGCAGCCAAACACCACTCCACGC
CTCTCATCGTCTGCGCACCCATGTTCAAGCTCTCTCCTCAGTTCCCCAGTGAAGAAGATTCATT
TCACAAGTTTGTGGCTCCTGAAGAAGTCCTTCCTTTCACAGAAGGAGACATTCTGGAGAAGGTC
AGTGTCCACTGTCCTGTGTTTGACTACGTGCCCCCTGACCTCATTACCCTCTTTATCTCCAACA
TTGGTGGGAATGCACCGTCCTACGTCTACCGCCTGATGAGCGAGCTCTACCATCCTGACGACCA
TGTCCTCTGACACGGCCTGTCCTATGCGGAACCAGCTTAGACCCGGAGTGGAGTGGAGACACAG
TGTTGCTGCTGCAGTGGGGACTGGAGAGTCAGCCTGAACCCTCAGTGCCTGTCGCCTGCCTTCC
TACTCATGCCCAGTGAGGAGTGGTCCAGGACTGCTCCTGCCTTCTGGGCTTATCTGAGCAGCAG
GCCTTGCTTCCCTGGCATTTTGGGGCCACTTTGTGACTAGGCTATGTTTGTTTCAGGAACTTCA
ACCTCCTGGCTCTGTGGTGTGTTACACAGACATACCATGACTACTTTTGCTGGGTCGGTGTTTG
CTCAGAAATGCCTTCCAGACCTTTTCCTAGGCTGTGCCAATAAAAGCTACTGGAAACTCAAAAA
AAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_114447	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB38753	(Get FASTA)	NCBI Sequence Viewer
	AAB58527	(Get FASTA)	NCBI Sequence Viewer
	AAH70506	(Get FASTA)	NCBI Sequence Viewer
	EDL81556	(Get FASTA)	NCBI Sequence Viewer
	EDL81557	(Get FASTA)	NCBI Sequence Viewer
	EDL81558	(Get FASTA)	NCBI Sequence Viewer
	EDL81559	(Get FASTA)	NCBI Sequence Viewer
	EDL81560	(Get FASTA)	NCBI Sequence Viewer
	EDL81561	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008730
GenBank Protein	Q62818	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114447 ⟸ NM_032058

- UniProtKB:

Q62818 (UniProtKB/Swiss-Prot), O08956 (UniProtKB/Swiss-Prot), Q6IRS8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPGAAAKGSELSERIESFVETLKRGGGRRSSEDMARETLGLLRRLITDHHWNNAGDLMDLIRRE
GRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLSEDFSFHYAP
LKSNIIEAINELLVELEGTTENIAAQALEHIHSNEVIMTIGFSRTVEAFLREAAQKRKFHVIAA
ECAPFCQGHEMAVNLSEAGIETTVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLAL
AAKHHSTPLIVCAPMFKLSPQFPSEEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPDL
ITLFISNIGGNAPSYVYRLMSELYHPDDHVL

hide sequence

Ensembl Acc Id:

ENSRNOP00000008730 ⟸ ENSRNOT00000008730

Ensembl Acc Id:

ENSRNOP00000086822 ⟸ ENSRNOT00000107973

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62818-F1-model_v2	AlphaFold	Q62818	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694737

Promoter ID:

EPDNEW_R5262

Type:

single initiation site

Name:

Eif2b2_1

Description:

eukaryotic translation initiation factor 2B subunit beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	109,044,242 - 109,044,302	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620820	AgrOrtholog
BioCyc Gene	G2FUF-36792	BioCyc
Ensembl Genes	ENSRNOG00000006467	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000008730	ENTREZGENE
Gene3D-CATH	Translation initiation factor eif-2b, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7097686	IMAGE-MGC_LOAD
InterPro	eIF2B_beta_subunit	UniProtKB/Swiss-Prot
	IF-2B-related	UniProtKB/Swiss-Prot
	IF_2B-like_C	UniProtKB/Swiss-Prot
	NagB/RpiA_transferase-like	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91604	IMAGE-MGC_LOAD
NCBI Gene	84005	ENTREZGENE
PANTHER	TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT BETA	UniProtKB/Swiss-Prot
	TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT BETA	UniProtKB/Swiss-Prot
Pfam	IF-2B	UniProtKB/Swiss-Prot
PhenoGen	Eif2b2	PhenoGen
RatGTEx	ENSRNOG00000006467	RatGTEx
Superfamily-SCOP	SSF100950	UniProtKB/Swiss-Prot
UniProt	A0A8I6GEG4_RAT	UniProtKB/TrEMBL
	A6JE12_RAT	UniProtKB/TrEMBL
	A6JE13_RAT	UniProtKB/TrEMBL
	A6JE15_RAT	UniProtKB/TrEMBL
	A6JE16_RAT	UniProtKB/TrEMBL
	A6JE17_RAT	UniProtKB/TrEMBL
	EI2BB_RAT	UniProtKB/Swiss-Prot
	F7EVX2_RAT	UniProtKB/TrEMBL
	O08956	ENTREZGENE
	Q62818	ENTREZGENE
	Q6IRS8	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	O08956	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-26	Eif2b2	eukaryotic translation initiation factor 2B subunit beta	Eif2b2	eukaryotic translation initiation factor 2B subunit 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-25	Eif2b2	eukaryotic translation initiation factor 2B subunit 2	Eif2b2	eukaryotic translation initiation factor 2B, subunit 2 beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Eif2b2	eukaryotic translation initiation factor 2B, subunit 2 beta		eukaryotic translation initiation factor 2B, subunit 2 (beta, 39kD)	Name updated	1299863	APPROVED
2002-08-07	Eif2b2	eukaryotic translation initiation factor 2B, subunit 2 (beta, 39kD)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	shares significant homology with corresponding yeast (S. cerevisiae) subunits	632563
gene_homology	strong conservation of C-terminal regions between yeast (S. cerevisiae) worm (C. elegans) and mammalian sequences	632563

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)