Symbol:
Pnliprp2
Name:
pancreatic lipase related protein 2
RGD ID:
620793
Description:
Enables galactolipase activity; phospholipase activity; and triacylglycerol lipase activity. Involved in several processes, including galactolipid catabolic process; response to food; and response to glucocorticoid. Located in extracellular space; neuron projection; and zymogen granule membrane. Orthologous to human PNLIPRP2 (pancreatic lipase related protein 2 (gene/pseudogene)); PARTICIPATES IN retinol metabolic pathway; glycerolipid metabolic pathway; INTERACTS WITH 1,2-didecanoylglycerol; atrazine; copper atom.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cytotoxic T lymphocyte lipase; galactolipase; pancreatic lipase-related protein 2; PL-RP2; secretory glycoprotein GP-3; triacylglycerol lipase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 267,883,906 - 267,902,572 (+) NCBI GRCr8 mRatBN7.2 1 257,897,766 - 257,916,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 257,897,766 - 257,916,434 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 266,101,911 - 266,120,618 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 272,807,924 - 272,826,613 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 265,450,439 - 265,469,037 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 279,896,973 - 279,927,600 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 279,896,973 - 279,927,600 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 287,257,993 - 287,290,491 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 265,267,609 - 265,285,920 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 265,478,653 - 265,496,965 (+) NCBI Celera 1 253,553,443 - 253,571,751 (+) NCBI Celera Cytogenetic Map 1 q55 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pnliprp2 Rat 1,2-didecanoylglycerol increases metabolic processing EXP 6480464 PNLIPRP2 protein results in increased metabolism of 1,2-didecanoylglycerol CTD PMID:9822688 Pnliprp2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:733601 6480464 1,2-Dimethylhydrazine results in increased expression of PNLIPRP2 mRNA CTD PMID:22206623 Pnliprp2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:733601 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PNLIPRP2 mRNA CTD PMID:17942748 Pnliprp2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:733601 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PNLIPRP2 mRNA CTD PMID:17942748 Pnliprp2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:733601 6480464 bisphenol S results in decreased methylation of PNLIPRP2 promoter CTD PMID:33297965 Pnliprp2 Rat aflatoxin B1 increases methylation ISO RGD:733600 6480464 Aflatoxin B1 results in increased methylation of PNLIPRP2 intron CTD PMID:30157460 Pnliprp2 Rat aldrin increases expression ISO RGD:733601 6480464 Aldrin results in increased expression of PNLIPRP2 mRNA CTD PMID:18579281 Pnliprp2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PNLIPRP2 gene CTD PMID:28931070 Pnliprp2 Rat belinostat decreases expression ISO RGD:733600 6480464 belinostat results in decreased expression of PNLIPRP2 mRNA CTD PMID:27188386 Pnliprp2 Rat benzo[a]pyrene multiple interactions ISO RGD:733601 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to PNLIPRP2 promoter] CTD PMID:19654925 Pnliprp2 Rat benzo[a]pyrene decreases methylation ISO RGD:733600 6480464 Benzo(a)pyrene results in decreased methylation of PNLIPRP2 promoter CTD PMID:27901495 Pnliprp2 Rat Benzo[ghi]perylene increases expression ISO RGD:733601 6480464 1,12-benzoperylene results in increased expression of PNLIPRP2 mRNA CTD PMID:26377693 Pnliprp2 Rat bezafibrate increases expression ISO RGD:733601 6480464 Bezafibrate results in increased expression of PNLIPRP2 mRNA CTD PMID:18787029 Pnliprp2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:733601 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of PNLIPRP2 mRNA CTD PMID:31606821 Pnliprp2 Rat butanal increases expression ISO RGD:733600 6480464 butyraldehyde results in increased expression of PNLIPRP2 mRNA CTD PMID:26079696 Pnliprp2 Rat carbon nanotube decreases expression ISO RGD:733601 6480464 Nanotubes, Carbon analog results in decreased expression of PNLIPRP2 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Pnliprp2 Rat chloroethene increases expression ISO RGD:733601 6480464 Vinyl Chloride results in increased expression of PNLIPRP2 mRNA CTD PMID:18579281 Pnliprp2 Rat ciguatoxin CTX1B affects expression ISO RGD:733601 6480464 Ciguatoxins affects the expression of PNLIPRP2 mRNA CTD PMID:18353800 Pnliprp2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of PNLIPRP2 mRNA CTD PMID:19821111 Pnliprp2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of PNLIPRP2 mRNA CTD PMID:19821111 Pnliprp2 Rat copper(II) sulfate decreases expression ISO RGD:733600 6480464 Copper Sulfate results in decreased expression of PNLIPRP2 mRNA CTD PMID:19549813 Pnliprp2 Rat diclofenac increases expression ISO RGD:733601 6480464 Diclofenac results in increased expression of PNLIPRP2 mRNA CTD PMID:26934552 Pnliprp2 Rat dorsomorphin multiple interactions ISO RGD:733600 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pnliprp2 Rat epoxiconazole increases expression ISO RGD:733601 6480464 epoxiconazole results in increased expression of PNLIPRP2 mRNA CTD PMID:35436446 Pnliprp2 Rat ethanolamine increases metabolic processing EXP 6480464 PNLIPRP2 protein results in increased metabolism of Ethanolamine CTD PMID:9822688 Pnliprp2 Rat iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of PNLIPRP2 mRNA CTD PMID:16629162 Pnliprp2 Rat iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of PNLIPRP2 mRNA CTD PMID:16629162 Pnliprp2 Rat methotrexate affects expression ISO RGD:733601 6480464 Methotrexate affects the expression of PNLIPRP2 mRNA CTD PMID:18502557 Pnliprp2 Rat orlistat decreases activity ISO RGD:733600 6480464 orlistat results in decreased activity of PNLIPRP2 protein CTD PMID:17401110 Pnliprp2 Rat orlistat decreases activity EXP 6480464 Orlistat results in decreased activity of PNLIPRP2 protein CTD PMID:9822688 Pnliprp2 Rat paraoxon decreases activity ISO RGD:733600 6480464 Paraoxon results in decreased activity of PNLIPRP2 protein CTD PMID:17401110 Pnliprp2 Rat paraoxon decreases activity EXP 6480464 Paraoxon results in decreased activity of PNLIPRP2 protein CTD PMID:9822688 Pnliprp2 Rat pentanal increases expression ISO RGD:733600 6480464 pentanal results in increased expression of PNLIPRP2 mRNA CTD PMID:26079696 Pnliprp2 Rat pirinixic acid decreases expression ISO RGD:733601 6480464 pirinixic acid results in decreased expression of PNLIPRP2 mRNA CTD PMID:17426115 Pnliprp2 Rat pirinixic acid multiple interactions ISO RGD:733601 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Pnliprp2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PNLIPRP2 mRNA CTD PMID:12832660 Pnliprp2 Rat propanal increases expression ISO RGD:733600 6480464 propionaldehyde results in increased expression of PNLIPRP2 mRNA CTD PMID:26079696 Pnliprp2 Rat SB 431542 multiple interactions ISO RGD:733600 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pnliprp2 Rat silver atom increases expression ISO RGD:733601 6480464 Silver results in increased expression of PNLIPRP2 mRNA CTD PMID:27131904 Pnliprp2 Rat silver(0) increases expression ISO RGD:733601 6480464 Silver results in increased expression of PNLIPRP2 mRNA CTD PMID:27131904 Pnliprp2 Rat sodium arsenite decreases expression ISO RGD:733600 6480464 sodium arsenite results in decreased expression of PNLIPRP2 mRNA CTD PMID:29301061 Pnliprp2 Rat sodium arsenite decreases expression ISO RGD:733601 6480464 sodium arsenite results in decreased expression of PNLIPRP2 mRNA CTD PMID:37682722 Pnliprp2 Rat streptozocin multiple interactions ISO RGD:733601 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in decreased expression of PNLIPRP2 mRNA CTD PMID:31606821 Pnliprp2 Rat streptozocin increases expression ISO RGD:733601 6480464 Streptozocin results in increased expression of PNLIPRP2 mRNA CTD PMID:31606821 Pnliprp2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PNLIPRP2 mRNA CTD PMID:33387578 Pnliprp2 Rat triptonide increases expression ISO RGD:733601 6480464 triptonide results in increased expression of PNLIPRP2 mRNA CTD PMID:33045310 Pnliprp2 Rat valproic acid affects expression ISO RGD:733600 6480464 Valproic Acid affects the expression of PNLIPRP2 mRNA CTD PMID:25979313 Pnliprp2 Rat valproic acid increases methylation ISO RGD:733600 6480464 Valproic Acid results in increased methylation of PNLIPRP2 gene CTD PMID:29501571 Pnliprp2 Rat valproic acid multiple interactions ISO RGD:733600 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pnliprp2 Rat valproic acid increases expression ISO RGD:733600 6480464 Valproic Acid results in increased expression of PNLIPRP2 mRNA CTD PMID:24383497|PMID:26272509|PMID:28001369 Pnliprp2 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PNLIPRP2 mRNA CTD PMID:15671213 Pnliprp2 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PNLIPRP2 mRNA CTD PMID:15671213
Imported Annotations - KEGG (archival)
1.
Pancreatic lipase-related protein 2 but not classical pancreatic lipase hydrolyzes galactolipids.
Andersson L, etal., Biochim Biophys Acta. 1996 Aug 16;1302(3):236-40.
2.
Pancreatic lipase and its related protein 2 are regulated by dietary polyunsaturated fat during the postnatal development of rats.
Birk RZ, etal., Pediatr Res. 2004 Aug;56(2):256-62. Epub 2004 Jun 4.
3.
Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species.
De Caro J, etal., Biochim Biophys Acta. 1998 Sep 8;1387(1-2):331-41.
4.
Leptin directly regulates exocrine pancreas lipase and two related proteins in the rat.
Elinson N, etal., Br J Nutr. 2006 Oct;96(4):691-6.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.
Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
8.
Rat GP-3 is a pancreatic lipase with kinetic properties that differ from colipase-dependent pancreatic lipase.
Jennens ML and Lowe ME, J Lipid Res. 1995 Nov;36(11):2374-82.
9.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
10.
PLRP2 selectively localizes synaptic membrane proteins via acyl-chain remodeling of phospholipids.
Kuge H, etal., J Lipid Res. 2020 Dec;61(12):1747-1763. doi: 10.1194/jlr.RA120001087. Epub 2020 Sep 22.
11.
Dexamethasone-regulated expression of pancreatic lipase and two related proteins in AR42J cells.
Kullman J, etal., Am J Physiol. 1996 May;270(5 Pt 1):G746-51.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
Rat pancreatic lipase and two related proteins: enzymatic properties and mRNA expression during development.
Payne RM, etal., Am J Physiol 1994 May;266(5 Pt 1):G914-21.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Consequences of metabolic challenges on hypothalamic colipase and PLRP2 mRNA in rats.
Rippe C, etal., Brain Res. 2007 Dec 14;1185:152-7. Epub 2007 Sep 20.
20.
Structure and activity of rat pancreatic lipase-related protein 2.
Roussel A, etal., J Biol Chem. 1998 Nov 27;273(48):32121-8.
21.
Identification and cloning of GP-3 from rat pancreatic acinar zymogen granules as a glycosylated membrane-associated lipase.
Wishart MJ, etal., J Biol Chem 1993 May 15;268(14):10303-11.
Pnliprp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 267,883,906 - 267,902,572 (+) NCBI GRCr8 mRatBN7.2 1 257,897,766 - 257,916,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 257,897,766 - 257,916,434 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 266,101,911 - 266,120,618 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 272,807,924 - 272,826,613 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 265,450,439 - 265,469,037 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 279,896,973 - 279,927,600 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 279,896,973 - 279,927,600 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 287,257,993 - 287,290,491 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 265,267,609 - 265,285,920 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 265,478,653 - 265,496,965 (+) NCBI Celera 1 253,553,443 - 253,571,751 (+) NCBI Celera Cytogenetic Map 1 q55 NCBI
PNLIPRP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 116,620,953 - 116,645,143 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 116,620,953 - 116,645,143 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 118,380,465 - 118,404,654 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 118,370,455 - 118,394,644 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 118,370,807 - 118,394,642 NCBI Celera 10 112,109,764 - 112,134,082 (+) NCBI Celera Cytogenetic Map 10 q25.3 NCBI HuRef 10 112,007,738 - 112,032,839 (+) NCBI HuRef CHM1_1 10 118,663,594 - 118,687,784 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 117,515,050 - 117,539,456 (+) NCBI T2T-CHM13v2.0
Pnliprp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 58,748,155 - 58,765,966 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 58,748,151 - 58,765,966 (+) Ensembl GRCm39 Ensembl GRCm38 19 58,759,723 - 58,777,534 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 58,759,719 - 58,777,534 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 58,834,213 - 58,852,024 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 58,812,979 - 58,830,778 (+) NCBI MGSCv36 mm8 Celera 19 60,956,809 - 60,974,415 (+) NCBI Celera Cytogenetic Map 19 D2 NCBI cM Map 19 54.5 NCBI
Pnliprp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 21,425,330 - 21,442,979 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 21,425,345 - 21,442,979 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100993654 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 128,480,002 - 128,514,403 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 128,485,341 - 128,519,742 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 113,203,170 - 113,216,890 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 116,634,191 - 116,658,075 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 116,634,538 - 116,658,075 (+) Ensembl panpan1.1 panPan2
PNLIPRP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 27,190,641 - 27,212,185 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 27,139,230 - 27,212,178 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 27,341,283 - 27,362,831 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 27,727,419 - 27,749,010 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 27,675,917 - 27,749,003 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 27,281,905 - 27,303,486 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 27,301,344 - 27,322,904 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 27,490,302 - 27,511,858 (+) NCBI UU_Cfam_GSD_1.0
PNLIPRP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 126,817,642 - 126,839,259 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 126,817,647 - 126,839,273 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 138,114,396 - 138,135,435 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103216568
Pnliprp2
.
Predicted Target Of
Count of predictions: 117 Count of miRNA genes: 96 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000068119 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1598839 Rf56 Renal function QTL 56 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 245907761 257976495 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat
RH131336
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 257,916,217 - 257,916,431 (+) MAPPER mRatBN7.2 Rnor_6.0 1 279,927,384 - 279,927,597 NCBI Rnor6.0 Rnor_5.0 1 287,290,275 - 287,290,488 UniSTS Rnor5.0 RGSC_v3.4 1 265,285,704 - 265,285,917 UniSTS RGSC3.4 Celera 1 253,571,535 - 253,571,748 UniSTS RH 3.4 Map 1 1690.1 UniSTS Cytogenetic Map 1 q55 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
8
43
52
34
33
18
17
18
127
68
44
31
47
15
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068119 ⟹ ENSRNOP00000063609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 257,897,766 - 257,916,434 (+) Ensembl Rnor_6.0 Ensembl 1 279,896,973 - 279,927,600 (+) Ensembl
RefSeq Acc Id:
NM_057206 ⟹ NP_476554
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 267,883,906 - 267,902,572 (+) NCBI mRatBN7.2 1 257,897,766 - 257,916,434 (+) NCBI Rnor_6.0 1 279,896,973 - 279,927,600 (+) NCBI Rnor_5.0 1 287,257,993 - 287,290,491 (+) NCBI RGSC_v3.4 1 265,267,609 - 265,285,920 (+) RGD Celera 1 253,553,443 - 253,571,751 (+) RGD
Sequence:
AGTTGTTCACATTCCGCAGTGCACTCTAGAATTAACTGCTTCTTTGAGTCTGGCCTCTGCTGGCCTCATCCTTATCCTATGCCTAGGGGTGTCAGTGGAAATCTGTTTCCATCTGTGCAGATGTTGCT
hide sequence
RefSeq Acc Id:
NP_476554 ⟸ NM_057206
- Peptide Label:
precursor
- UniProtKB:
P54318 (UniProtKB/Swiss-Prot), D3ZX17 (UniProtKB/TrEMBL), A6JI68 (UniProtKB/TrEMBL)
- Sequence:
MPRGVSGNLFPSVQMLLCWIVSLLLATVGGKEVCYGHLGCFSNDKPWAGMLQRPLKIFPWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQV
hide sequence
Ensembl Acc Id:
ENSRNOP00000063609 ⟸ ENSRNOT00000068119
RGD ID: 13691010 Promoter ID: EPDNEW_R1535 Type: multiple initiation site Name: Pnliprp2_1 Description: pancreatic lipase related protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 279,896,981 - 279,897,041 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Pnliprp2
pancreatic lipase related protein 2
Pnliprp2
pancreatic lipase-related protein 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
Note Type
Note
Reference
gene_expression
expressed specifically in pancreas
633718
gene_protein
452 amino acids; 53 kDa glycoprotein
633718
