Advanced Search (OLGA)

Gene: Pnliprp2 (pancreatic lipase related protein 2) Rattus norvegicus

Analyze

Symbol:

Pnliprp2

Name:

pancreatic lipase related protein 2

RGD ID:

620793

Description:

Enables galactolipase activity; phospholipase activity; and triacylglycerol lipase activity. Involved in several processes, including galactolipid catabolic process; response to food; and response to glucocorticoid. Located in extracellular space; neuron projection; and zymogen granule membrane. Orthologous to human PNLIPRP2 (pancreatic lipase related protein 2 (gene/pseudogene)); PARTICIPATES IN retinol metabolic pathway; glycerolipid metabolic pathway; INTERACTS WITH 1,2-didecanoylglycerol; atrazine; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cytotoxic T lymphocyte lipase; galactolipase; pancreatic lipase-related protein 2; PL-RP2; secretory glycoprotein GP-3; triacylglycerol lipase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PNLIPRP2 (pancreatic lipase related protein 2 (gene/pseudogene))	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):	Pnliprp2 (pancreatic lipase-related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pnliprp2 (pancreatic lipase related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100993654 (pancreatic lipase-related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PNLIPRP2 (pancreatic lipase related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PNLIPRP2 (pancreatic lipase related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103216568 (pancreatic lipase-related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pnliprp2 (pancreatic lipase related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PNLIPRP1 (pancreatic lipase related protein 1)	HGNC	OrthoDB
Homo sapiens (human):	PNLIP (pancreatic lipase)	HGNC	OrthoDB
Homo sapiens (human):	SLC13A5 (solute carrier family 13 member 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PNLIPRP2 (pancreatic lipase related protein 2 (gene/pseudogene))	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pnliprp2 (pancreatic lipase-related protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG34448	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5966	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5966	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6847	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG6283	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6271	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17191	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6277	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10116	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pnliprp3	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pnlip	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100488279	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100486017	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100486161	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100489174	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100486017	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	267,883,906 - 267,902,572 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	267,883,906 - 267,902,572 (+)	Ensembl				GRCr8
mRatBN7.2	1	257,897,766 - 257,916,434 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	257,897,766 - 257,916,434 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	266,101,911 - 266,120,618 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	272,807,924 - 272,826,613 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	265,450,439 - 265,469,037 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	279,896,973 - 279,927,600 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	279,896,973 - 279,927,600 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	287,257,993 - 287,290,491 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	265,267,609 - 265,285,920 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	253,553,443 - 253,571,751 (+)	NCBI		Celera
RGSC_v3.1	1	265,478,653 - 265,496,965 (+)	NCBI
Cytogenetic Map	1	q55	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-didecanoylglycerol (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

aldrin (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bezafibrate (ISO)

bis(2-ethylhexyl) phthalate (ISO)

butanal (ISO)

carbon nanotube (ISO)

chloroethene (ISO)

ciguatoxin CTX1B (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

diclofenac (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

ethanolamine (EXP)

iron atom (EXP)

iron(0) (EXP)

methotrexate (ISO)

orlistat (EXP,ISO)

paraoxon (EXP,ISO)

pentanal (ISO)

pirinixic acid (EXP,ISO)

propanal (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular defense response (ISO)

cholesterol homeostasis (IBA)

fatty acid biosynthetic process (IBA)

galactolipid catabolic process (IDA,ISO)

high-density lipoprotein particle remodeling (IBA)

intestinal lipid catabolic process (ISO)

lipid catabolic process (IEA)

lipid metabolic process (IEA)

phosphatidylcholine catabolic process (ISO,ISS)

phospholipid catabolic process (IBA,ISO,ISS)

phospholipid metabolic process (IMP)

post-embryonic development (IEP)

response to bacterium (ISO)

response to food (IEP)

response to glucocorticoid (IEP)

response to lipid (IEP)

response to peptide hormone (IEP)

triglyceride catabolic process (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasmic vesicle (IEA)

extracellular region (IEA)

extracellular space (IBA,IDA,ISO)

neuron projection (IDA,IEA)

zymogen granule membrane (IDA,IEA)

Molecular Function

calcium ion binding (ISO,ISS)

carboxylic ester hydrolase activity (IEA)

galactolipase activity (IBA,IDA,IEA,ISO)

glycerophospholipase activity (IDA,ISO)

hydrolase activity (IEA)

lipase activity (IDA,IEA)

lipoprotein lipase activity (IBA)

metal ion binding (IEA)

monoacylglycerol lipase activity (ISO,ISS)

phospholipase A1 activity (IBA)

protein binding (ISO)

triacylglycerol lipase activity (IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glycerolipid metabolic pathway (IEA)

retinol metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Pancreatic lipase-related protein 2 but not classical pancreatic lipase hydrolyzes galactolipids.	Andersson L, etal., Biochim Biophys Acta. 1996 Aug 16;1302(3):236-40.
2.	Pancreatic lipase and its related protein 2 are regulated by dietary polyunsaturated fat during the postnatal development of rats.	Birk RZ, etal., Pediatr Res. 2004 Aug;56(2):256-62. Epub 2004 Jun 4.
3.	Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species.	De Caro J, etal., Biochim Biophys Acta. 1998 Sep 8;1387(1-2):331-41.
4.	Leptin directly regulates exocrine pancreas lipase and two related proteins in the rat.	Elinson N, etal., Br J Nutr. 2006 Oct;96(4):691-6.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.	Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
8.	Rat GP-3 is a pancreatic lipase with kinetic properties that differ from colipase-dependent pancreatic lipase.	Jennens ML and Lowe ME, J Lipid Res. 1995 Nov;36(11):2374-82.
9.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
10.	PLRP2 selectively localizes synaptic membrane proteins via acyl-chain remodeling of phospholipids.	Kuge H, etal., J Lipid Res. 2020 Dec;61(12):1747-1763. doi: 10.1194/jlr.RA120001087. Epub 2020 Sep 22.
11.	Dexamethasone-regulated expression of pancreatic lipase and two related proteins in AR42J cells.	Kullman J, etal., Am J Physiol. 1996 May;270(5 Pt 1):G746-51.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Rat pancreatic lipase and two related proteins: enzymatic properties and mRNA expression during development.	Payne RM, etal., Am J Physiol 1994 May;266(5 Pt 1):G914-21.
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Consequences of metabolic challenges on hypothalamic colipase and PLRP2 mRNA in rats.	Rippe C, etal., Brain Res. 2007 Dec 14;1185:152-7. Epub 2007 Sep 20.
20.	Structure and activity of rat pancreatic lipase-related protein 2.	Roussel A, etal., J Biol Chem. 1998 Nov 27;273(48):32121-8.
21.	Identification and cloning of GP-3 from rat pancreatic acinar zymogen granules as a glycosylated membrane-associated lipase.	Wishart MJ, etal., J Biol Chem 1993 May 15;268(14):10303-11.

Additional References at PubMed

PMID:9813028	PMID:17805199	PMID:18702514	PMID:21382969	PMID:23012479

Genomics

Comparative Map Data

Pnliprp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	267,883,906 - 267,902,572 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	267,883,906 - 267,902,572 (+)	Ensembl				GRCr8
mRatBN7.2	1	257,897,766 - 257,916,434 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	257,897,766 - 257,916,434 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	266,101,911 - 266,120,618 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	272,807,924 - 272,826,613 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	265,450,439 - 265,469,037 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	279,896,973 - 279,927,600 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	279,896,973 - 279,927,600 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	287,257,993 - 287,290,491 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	265,267,609 - 265,285,920 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	253,553,443 - 253,571,751 (+)	NCBI		Celera
RGSC_v3.1	1	265,478,653 - 265,496,965 (+)	NCBI
Cytogenetic Map	1	q55	NCBI

PNLIPRP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	116,620,953 - 116,645,143 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	116,620,953 - 116,645,143 (+)	Ensembl			hg38	GRCh38
GRCh37	10	118,380,465 - 118,404,654 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	118,370,455 - 118,394,644 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	118,370,807 - 118,394,642	NCBI
Celera	10	112,109,764 - 112,134,082 (+)	NCBI		Celera
Cytogenetic Map	10	q25.3	NCBI
HuRef	10	112,007,738 - 112,032,839 (+)	NCBI		HuRef
CHM1_1	10	118,663,594 - 118,687,784 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	117,515,050 - 117,539,456 (+)	NCBI		T2T-CHM13v2.0

Pnliprp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	58,748,155 - 58,765,966 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	58,748,151 - 58,765,966 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	58,759,723 - 58,777,534 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	58,759,719 - 58,777,534 (+)	Ensembl			mm10	GRCm38
MGSCv37	19	58,834,213 - 58,852,024 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	58,812,979 - 58,830,778 (+)	NCBI		MGSCv36	mm8
Celera	19	60,956,809 - 60,974,415 (+)	NCBI		Celera
Cytogenetic Map	19	D2	NCBI
cM Map	19	54.5	NCBI

Pnliprp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	21,425,330 - 21,442,979 (+)	Ensembl
ChiLan1.0	NW_004955431	21,425,345 - 21,442,979 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100993654
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	128,480,002 - 128,514,403 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	128,485,341 - 128,519,742 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	113,203,170 - 113,216,890 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	116,634,191 - 116,658,075 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	116,634,538 - 116,658,075 (+)	Ensembl			panPan2	panpan1.1

PNLIPRP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	27,190,641 - 27,212,185 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	27,139,230 - 27,212,178 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	27,341,283 - 27,362,831 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	27,727,419 - 27,749,010 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	27,675,917 - 27,749,003 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	27,281,905 - 27,303,486 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	27,301,344 - 27,322,904 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	27,490,302 - 27,511,858 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

PNLIPRP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	126,817,642 - 126,839,259 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	126,817,647 - 126,839,273 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	138,114,396 - 138,135,435 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103216568
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	109,428,235 - 109,453,687 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	70,683,089 - 70,708,007 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pnliprp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	29,936,277 - 29,952,794 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	29,936,223 - 29,955,265 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	117
Count of miRNA genes:	96
Interacting mature miRNAs:	107
Transcripts:	ENSRNOT00000068119
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	263946994	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1600390	Niddm64	Non-insulin dependent diabetes mellitus QTL 64		0.003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	257624997	270518180	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

RH131336

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	257,916,217 - 257,916,431 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	279,927,384 - 279,927,597	NCBI	Rnor6.0
Rnor_5.0	1	287,290,275 - 287,290,488	UniSTS	Rnor5.0
RGSC_v3.4	1	265,285,704 - 265,285,917	UniSTS	RGSC3.4
Celera	1	253,571,535 - 253,571,748	UniSTS
RH 3.4 Map	1	1690.1	UniSTS
Cytogenetic Map	1	q55	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	8	45	52	34	33	18	18	18	135	71	44	34	49	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L09216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068119 ⟹ ENSRNOP00000063609

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	267,883,906 - 267,902,572 (+)	Ensembl
mRatBN7.2 Ensembl	1	257,897,766 - 257,916,434 (+)	Ensembl
Rnor_6.0 Ensembl	1	279,896,973 - 279,927,600 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000146115 ⟹ ENSRNOP00000098752

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	267,883,906 - 267,901,175 (+)	Ensembl

RefSeq Acc Id:

NM_057206 ⟹ NP_476554

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	267,883,906 - 267,902,572 (+)	NCBI
mRatBN7.2	1	257,897,766 - 257,916,434 (+)	NCBI
Rnor_6.0	1	279,896,973 - 279,927,600 (+)	NCBI
Rnor_5.0	1	287,257,993 - 287,290,491 (+)	NCBI
RGSC_v3.4	1	265,267,609 - 265,285,920 (+)	RGD
Celera	1	253,553,443 - 253,571,751 (+)	RGD

Sequence:

show sequence

AGTTGTTCACATTCCGCAGTGCACTCTAGAATTAACTGCTTCTTTGAGTCTGGCCTCTGCTGGC
CTCATCCTTATCCTATGCCTAGGGGTGTCAGTGGAAATCTGTTTCCATCTGTGCAGATGTTGCT
CTGCTGGATCGTCAGTCTTCTGTTGGCCACTGTCGGAGGGAAAGAGGTTTGCTATGGACACCTT
GGCTGCTTTTCCAATGACAAGCCCTGGGCAGGGATGCTTCAGCGGCCTTTGAAGATATTCCCTT
GGTCCCCAGAGGACATCGATACACGCTTTCTTCTGTACACAAATGAGAATCCAAATAACTACCA
AAAAATCTCTGCCACCGAACCAGACACCATCAAGTTTTCCAACTTCCAACTGGACCGCAAGACG
CGTTTCATCGTCCATGGATTCATAGACAAGGGAGAGGATGGCTGGTTGCTGGACATGTGCAAGA
AAATGTTTCAAGTGGAGAAAGTGAACTGTATTTGCGTCGATTGGAGGCGAGGATCCAGGACTGA
ATACACCCAAGCCTCCTACAACACTCGGGTCGTGGGCGCTGAGATTGCCTTCCTAGTGCAAGTG
TTATCGACAGAGATGGGGTACAGCCCAGAGAATGTTCATCTCATCGGCCACAGCCTGGGCGCAC
ACGTGGTTGGGGAGGCAGGCAGGAGGCTGGAGGGCCATGTGGGCAGGATTACAGGGCTGGACCC
TGCAGAGCCCTGTTTCCAAGGCCTGCCAGAGGAAGTTCGGTTGGACCCATCGGATGCCATGTTT
GTAGACGTGATCCACACAGATAGTGCTCCCATAATTCCCTATCTAGGTTTTGGAATGAGCCAAA
AGGTCGGACATCTGGATTTCTTCCCCAATGGAGGGAAGGAAATGCCAGGATGTCAGAAAAACAT
CCTTTCCACCATTGTTGATATCAACGGGATATGGGAAGGAACTCAAAACTTTGTAGCCTGCAAC
CACCTGCGGAGCTACAAGTACTACGCCAGCAGCATCCTCAACCCCGACGGCTTCCTGGGGTACC
CTTGCTCTTCCTATGAGAAGTTCCAGCAGAATGACTGCTTCCCTTGTCCAGAAGAAGGGTGTCC
CAAAATGGGGCACTATGCTGATCAATTTGAGGGGAAAACCGCTACTGTGGAACAAACCGTTTAT
CTGAATACAGGAGATAGTGGTAACTTTACTCGTTGGAGATACAAAGTATCAGTCACACTGTCAG
GAGCAAAGAAACTGAGTGGGTACATCTTGGTTGCTCTGTACGGAAATAATGGAAACTCAAAGCA
GTATGAAATTTTCAAAGGATCCCTCAAACCGGAAGCAAGGCATGTTCGTGACATTGATGTGGAC
ATCAATGTTGGAGAAATCCAGAAGGTTAAGTTCCTCTGGAACAACAAGGTGATAAATCTCTTCC
GGCCCACTCTGGGAGCTTCGCAGATCACAGTGCAAAGTGGTGTAGACGGGAAAGAGTACAACTT
CTGTAGCAGCGACACTGTGCGTGAAGACGTCTTACAGTCGCTTTATCCTTGTTAAAGATGTGCC
CGTGACTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_476554	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41250	(Get FASTA)	NCBI Sequence Viewer
	EDL94542	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063609
GenBank Protein	P54318	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_476554 ⟸ NM_057206
- Peptide Label:	precursor
- UniProtKB:	P54318 (UniProtKB/Swiss-Prot), D3ZX17 (UniProtKB/TrEMBL), A6JI68 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPRGVSGNLFPSVQMLLCWIVSLLLATVGGKEVCYGHLGCFSNDKPWAGMLQRPLKIFPWSPED IDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQV EKVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGE AGRRLEGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHL DFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSY EKFQQNDCFPCPEEGCPKMGHYADQFEGKTATVEQTVYLNTGDSGNFTRWRYKVSVTLSGAKKL SGYILVALYGNNGNSKQYEIFKGSLKPEARHVRDIDVDINVGEIQKVKFLWNNKVINLFRPTLG ASQITVQSGVDGKEYNFCSSDTVREDVLQSLYPC hide sequence

Ensembl Acc Id:

ENSRNOP00000063609 ⟸ ENSRNOT00000068119

Ensembl Acc Id:

ENSRNOP00000098752 ⟸ ENSRNOT00000146115

Protein Domains

PLAT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P54318-F1-model_v2	AlphaFold	P54318	1-468	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691010

Promoter ID:

EPDNEW_R1535

Type:

multiple initiation site

Name:

Pnliprp2_1

Description:

pancreatic lipase related protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	279,896,981 - 279,897,041	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620793	AgrOrtholog
BioCyc Gene	G2FUF-55268	BioCyc
Ensembl Genes	ENSRNOG00000017982	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000068119	ENTREZGENE
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
	PLAT/LH2 domain	UniProtKB/Swiss-Prot
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	Lipase/vitellogenin	UniProtKB/Swiss-Prot
	Lipase_LIPH	UniProtKB/Swiss-Prot
	Lipase_N	UniProtKB/Swiss-Prot
	Lipase_panc	UniProtKB/Swiss-Prot
	PLAT/LH2_dom	UniProtKB/Swiss-Prot
	PLAT/LH2_dom_sf	UniProtKB/Swiss-Prot
	TAG_lipase	UniProtKB/Swiss-Prot
KEGG Report	rno:117554	UniProtKB/Swiss-Prot
NCBI Gene	117554	ENTREZGENE
PANTHER	PANCREATIC LIPASE-RELATED PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR11610	UniProtKB/Swiss-Prot
Pfam	Lipase	UniProtKB/Swiss-Prot
	PLAT	UniProtKB/Swiss-Prot
PhenoGen	Pnliprp2	PhenoGen
PIRSF	Lipoprotein_lipase_LIPH	UniProtKB/Swiss-Prot
PRINTS	PANCLIPASE	UniProtKB/Swiss-Prot
	TAGLIPASE	UniProtKB/Swiss-Prot
PROSITE	LIPASE_SER	UniProtKB/Swiss-Prot
	PLAT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017982	RatGTEx
SMART	LH2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49723	UniProtKB/Swiss-Prot
	SSF53474	UniProtKB/Swiss-Prot
UniProt	A0ABK0KWK3_RAT	UniProtKB/TrEMBL
	A6JI68	ENTREZGENE, UniProtKB/TrEMBL
	D3ZX17	ENTREZGENE, UniProtKB/TrEMBL
	LIPR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Pnliprp2	pancreatic lipase related protein 2	Pnliprp2	pancreatic lipase-related protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed specifically in pancreas	633718
gene_protein	452 amino acids; 53 kDa glycoprotein	633718

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)