Symbol:
Rab3ip
Name:
RAB3A interacting protein
RGD ID:
620650
Description:
Enables GTPase binding activity and guanyl-nucleotide exchange factor activity. Involved in negative regulation of filopodium assembly. Located in cytosol; perinuclear region of cytoplasm; and proximal dendrite. Orthologous to human RAB3IP (RAB3A interacting protein); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rab family mediated signaling pathway; INTERACTS WITH 2,4-dinitrotoluene; 3H-1,2-dithiole-3-thione; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
rab-3A-interacting protein; RAB3A interacting protein (rabin3); RAB3A-interacting protein; rabin 3; rabin-3; RABIN3; SSX2-interacting protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAB3IP (RAB3A interacting protein) HGNC
EggNOG, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Rab3ip (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rab3ip (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAB3IP (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAB3IP (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rab3ip (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAB3IP (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAB3IP (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rab3ip (RAB3A interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
RAB3IP (RAB3A interacting protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rab3ip (RAB3A interacting protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rab3ip (RAB3A interacting protein (rabin3))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F54C9.11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SEC2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
rab3ip
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 54,417,418 - 54,461,253 (-) NCBI GRCr8 mRatBN7.2 7 52,531,461 - 52,575,295 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,532,401 - 52,561,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 54,439,162 - 54,467,810 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,642,257 - 56,670,909 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 56,420,162 - 56,448,806 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,927,486 - 59,971,518 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,928,426 - 59,957,232 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,932,332 - 59,976,359 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 56,229,363 - 56,258,007 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 56,250,358 - 56,278,708 (-) NCBI Celera 7 49,308,208 - 49,336,852 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) belinostat (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) caffeine (EXP,ISO) carbamazepine (ISO) clofibrate (ISO) coumarin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) fenthion (ISO) flavonoids (EXP) folic acid (ISO) gentamycin (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxyacetic acid (EXP) methoxychlor (EXP) methylmercury chloride (EXP) methylparaben (ISO) Monobutylphthalate (EXP) N-methyl-4-phenylpyridinium (ISO) nickel subsulfide (EXP) panobinostat (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) poly(I:C) (ISO) potassium chromate (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Interaction cloning of Rabin3, a novel protein that associates with the Ras-like GTPase Rab3A.
Brondyk WH, etal., Mol Cell Biol 1995 Mar;15(3):1137-43.
2.
NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by switching binding specificity from phosphatidylserine to Sec15.
Chiba S, etal., EMBO J. 2013 Mar 20;32(6):874-85. doi: 10.1038/emboj.2013.32. Epub 2013 Feb 22.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
A Rab8-specific GDP/GTP exchange factor is involved in actin remodeling and polarized membrane transport.
Hattula K, etal., Mol Biol Cell. 2002 Sep;13(9):3268-80.
5.
Signal transduction meets vesicle traffic: the software and hardware of GLUT4 translocation.
Klip A, etal., Am J Physiol Cell Physiol. 2014 May 15;306(10):C879-86. doi: 10.1152/ajpcell.00069.2014. Epub 2014 Mar 5.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Chemical genetic identification of NDR1/2 kinase substrates AAK1 and Rabin8 Uncovers their roles in dendrite arborization and spine development.
Ultanir SK, etal., Neuron. 2012 Mar 22;73(6):1127-42. doi: 10.1016/j.neuron.2012.01.019. Epub 2012 Mar 21.
Rab3ip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 54,417,418 - 54,461,253 (-) NCBI GRCr8 mRatBN7.2 7 52,531,461 - 52,575,295 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,532,401 - 52,561,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 54,439,162 - 54,467,810 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,642,257 - 56,670,909 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 56,420,162 - 56,448,806 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,927,486 - 59,971,518 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,928,426 - 59,957,232 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,932,332 - 59,976,359 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 56,229,363 - 56,258,007 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 56,250,358 - 56,278,708 (-) NCBI Celera 7 49,308,208 - 49,336,852 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
RAB3IP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 69,738,242 - 69,823,204 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 69,738,860 - 69,823,204 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 70,132,640 - 70,216,984 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 68,418,898 - 68,503,251 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 68,419,454 - 68,495,770 NCBI Celera 12 69,796,326 - 69,880,688 (+) NCBI Celera Cytogenetic Map 12 q15 NCBI HuRef 12 67,181,822 - 67,267,191 (+) NCBI HuRef CHM1_1 12 70,100,838 - 70,185,226 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 69,717,376 - 69,802,330 (+) NCBI T2T-CHM13v2.0
Rab3ip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 116,741,685 - 116,786,361 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 116,741,689 - 116,786,674 (-) Ensembl GRCm39 Ensembl GRCm38 10 116,905,780 - 116,950,456 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 116,905,784 - 116,950,769 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 116,342,840 - 116,387,436 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 116,309,894 - 116,354,490 (-) NCBI MGSCv36 mm8 Celera 10 118,848,689 - 118,893,539 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 64.96 NCBI
Rab3ip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 10,031,666 - 10,090,456 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 10,031,333 - 10,091,438 (+) NCBI ChiLan1.0 ChiLan1.0
RAB3IP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 77,771,315 - 77,849,587 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 77,767,715 - 77,845,985 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 67,265,922 - 67,344,241 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 70,035,629 - 70,107,689 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 70,035,629 - 70,107,689 (+) Ensembl panpan1.1 panPan2
RAB3IP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 11,673,749 - 11,714,282 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 11,673,777 - 11,714,281 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 11,604,813 - 11,645,346 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 11,797,196 - 11,837,976 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 11,797,167 - 11,839,204 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 11,663,957 - 11,704,723 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 11,911,509 - 11,952,195 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 12,034,352 - 12,075,134 (+) NCBI UU_Cfam_GSD_1.0
Rab3ip Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 46,499,946 - 46,551,861 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 7,570,492 - 7,611,536 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 7,558,256 - 7,610,178 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAB3IP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 34,003,180 - 34,053,896 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 34,002,792 - 34,053,893 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 36,601,756 - 36,652,151 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAB3IP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 65,370,960 - 65,435,097 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 65,371,044 - 65,434,820 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 180,255,380 - 180,321,086 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rab3ip
.
Predicted Target Of
Count of predictions: 207 Count of miRNA genes: 150 Interacting mature miRNAs: 173 Transcripts: ENSRNOT00000007258 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH131429
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 52,532,420 - 52,532,631 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,928,446 - 59,928,656 NCBI Rnor6.0 Rnor_5.0 7 59,933,292 - 59,933,502 UniSTS Rnor5.0 RGSC_v3.4 7 56,229,385 - 56,229,595 UniSTS RGSC3.4 Celera 7 49,308,230 - 49,308,440 UniSTS RH 3.4 Map 7 483.0 UniSTS Cytogenetic Map 7 q22 UniSTS
RH131529
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 52,545,293 - 52,545,508 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,941,319 - 59,941,533 NCBI Rnor6.0 Rnor_5.0 7 59,946,165 - 59,946,379 UniSTS Rnor5.0 RGSC_v3.4 7 56,242,258 - 56,242,472 UniSTS RGSC3.4 Celera 7 49,321,103 - 49,321,317 UniSTS RH 3.4 Map 7 480.4 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007258 ⟹ ENSRNOP00000007258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,532,401 - 52,561,043 (-) Ensembl Rnor_6.0 Ensembl 7 59,928,426 - 59,957,232 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081599 ⟹ ENSRNOP00000071773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,533,012 - 52,561,043 (-) Ensembl Rnor_6.0 Ensembl 7 59,928,867 - 59,957,228 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109052 ⟹ ENSRNOP00000079240
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,532,401 - 52,561,043 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118552 ⟹ ENSRNOP00000091358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,532,401 - 52,561,043 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118928 ⟹ ENSRNOP00000076496
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,534,087 - 52,561,043 (-) Ensembl
RefSeq Acc Id:
NM_017313 ⟹ NP_059009
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,418,356 - 54,447,000 (-) NCBI mRatBN7.2 7 52,532,399 - 52,561,043 (-) NCBI Rnor_6.0 7 59,928,424 - 59,957,232 (-) NCBI Rnor_5.0 7 59,932,332 - 59,976,359 (-) NCBI RGSC_v3.4 7 56,229,363 - 56,258,007 (-) RGD Celera 7 49,308,208 - 49,336,852 (-) RGD
Sequence:
AGCTTAGGCTGTCCTATGATGAAGTCTTGCTATGGCTAACGACCCCTTAGAAGGTTTCCATGAAGTGAACCTCGCTTCGCCTACCTCTCCAGACCTTCTTGGTGTGTGTGACCCGGGAACCCAAGAGC
hide sequence
RefSeq Acc Id:
XM_006241357 ⟹ XP_006241419
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,461,253 (-) NCBI mRatBN7.2 7 52,531,461 - 52,575,295 (-) NCBI Rnor_6.0 7 59,927,486 - 59,971,517 (-) NCBI Rnor_5.0 7 59,932,332 - 59,976,359 (-) NCBI
Sequence:
GCAGGCGCAGTCGGCTCTCCCTCCCTCGGCTCCCATCGCAGTGCGCCCGCCGCGGCGGAGTGGA
hide sequence
RefSeq Acc Id:
XM_006241360 ⟹ XP_006241422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,461,252 (-) NCBI mRatBN7.2 7 52,531,461 - 52,575,295 (-) NCBI Rnor_6.0 7 59,927,486 - 59,971,517 (-) NCBI Rnor_5.0 7 59,932,332 - 59,976,359 (-) NCBI
Sequence:
GCAGGCGCAGTCGGCTCTCCCTCCCTCGGCTCCCATCGCAGTGCGCCCGCCGCGGCGGAGTGGA
hide sequence
RefSeq Acc Id:
XM_008765383 ⟹ XP_008763605
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,445,114 (-) NCBI mRatBN7.2 7 52,531,461 - 52,559,156 (-) NCBI Rnor_6.0 7 59,927,486 - 59,955,295 (-) NCBI
Sequence:
CCTGTCCCGTTTACGGAGCCCATCTGTTCTGGAAGTTAGAGAGAAGGGCTACGAAAGGTTAAAA
hide sequence
RefSeq Acc Id:
XM_039078619 ⟹ XP_038934547
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,461,246 (-) NCBI mRatBN7.2 7 52,531,461 - 52,575,289 (-) NCBI
RefSeq Acc Id:
XM_039078620 ⟹ XP_038934548
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,428,623 (-) NCBI mRatBN7.2 7 52,531,461 - 52,542,669 (-) NCBI
RefSeq Acc Id:
XM_063263142 ⟹ XP_063119212
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,452,861 (-) NCBI
RefSeq Acc Id:
XM_063263143 ⟹ XP_063119213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,452,869 (-) NCBI
RefSeq Acc Id:
XM_063263144 ⟹ XP_063119214
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,452,870 (-) NCBI
RefSeq Acc Id:
XM_063263145 ⟹ XP_063119215
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,417,418 - 54,461,244 (-) NCBI
RefSeq Acc Id:
NP_059009 ⟸ NM_017313
- UniProtKB:
Q62739 (UniProtKB/Swiss-Prot), A1L127 (UniProtKB/TrEMBL), A0A0G2K1B4 (UniProtKB/TrEMBL)
- Sequence:
MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNLSDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQGATVTEAS
hide sequence
RefSeq Acc Id:
XP_006241422 ⟸ XM_006241360
- Peptide Label:
isoform X1
- UniProtKB:
Q62739 (UniProtKB/Swiss-Prot), A1L127 (UniProtKB/TrEMBL), A0A0G2K1B4 (UniProtKB/TrEMBL)
- Sequence:
MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNLSDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQGATVTEAS
hide sequence
RefSeq Acc Id:
XP_006241419 ⟸ XM_006241357
- Peptide Label:
isoform X1
- UniProtKB:
Q62739 (UniProtKB/Swiss-Prot), A1L127 (UniProtKB/TrEMBL), A0A0G2K1B4 (UniProtKB/TrEMBL)
- Sequence:
MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNLSDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQGATVTEAS
hide sequence
RefSeq Acc Id:
XP_008763605 ⟸ XM_008765383
- Peptide Label:
isoform X4
- UniProtKB:
A6IGQ0 (UniProtKB/TrEMBL)
- Sequence:
MSVIVALRTLRQEDCCDFEELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANVKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLAAGKTPFKRGHTRNKSTSSAMSG
hide sequence
Ensembl Acc Id:
ENSRNOP00000071773 ⟸ ENSRNOT00000081599
Ensembl Acc Id:
ENSRNOP00000007258 ⟸ ENSRNOT00000007258
RefSeq Acc Id:
XP_038934547 ⟸ XM_039078619
- Peptide Label:
isoform X5
- UniProtKB:
A6IGQ0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934548 ⟸ XM_039078620
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000076496 ⟸ ENSRNOT00000118928
Ensembl Acc Id:
ENSRNOP00000091358 ⟸ ENSRNOT00000118552
Ensembl Acc Id:
ENSRNOP00000079240 ⟸ ENSRNOT00000109052
RefSeq Acc Id:
XP_063119215 ⟸ XM_063263145
- Peptide Label:
isoform X5
- UniProtKB:
A6IGQ0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119214 ⟸ XM_063263144
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZML7 (UniProtKB/TrEMBL), A0A0G2K1B4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119213 ⟸ XM_063263143
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AR50 (UniProtKB/TrEMBL), A0A0G2K1B4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119212 ⟸ XM_063263142
- Peptide Label:
isoform X1
- UniProtKB:
Q62739 (UniProtKB/Swiss-Prot), A1L127 (UniProtKB/Swiss-Prot), A0A0G2K1B4 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-31
Rab3ip
RAB3A interacting protein
Rab3ip
RAB3A interacting protein (rabin3)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Rab3ip
RAB3A interacting protein (rabin3)
Rab3ip
RAB3A interacting protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Rab3ip
RAB3A interacting protein
RABIN3
rabin 3
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_domains
contains a coiled coil domain and a region with similarity to S. cerevisiae Sec2p
633748
gene_expression
abundantly expressed in testes
633748
