Hmga2 (high mobility group AT-hook 2)

Gene: Hmga2 (high mobility group AT-hook 2) Rattus norvegicus

Analyze

Symbol:

Hmga2

Name:

high mobility group AT-hook 2

RGD ID:

620617

Description:

Enables enzyme binding activity. Involved in negative regulation of intracellular steroid hormone receptor signaling pathway; negative regulation of receptor signaling pathway via JAK-STAT; and negative regulation of transcription by RNA polymerase II. Predicted to be located in male germ cell nucleus and nuclear chromosome. Predicted to be part of SMAD protein complex and senescence-associated heterochromatin focus. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Silver-Russell syndrome; leiomyoma; lipoma; and ovarian cancer. Orthologous to human HMGA2 (high mobility group AT-hook 2); PARTICIPATES IN Ras mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol; atrazine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

high mobility group protein HMGI-C; Hmgic; non-histone chromosomal architectural protein HMGI-C

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	57,762,710 - 57,884,555 (-)	NCBI		GRCr8
mRatBN7.2	7	55,877,145 - 55,998,813 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	55,880,112 - 55,994,784 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	57,786,495 - 57,901,148 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	59,989,707 - 60,104,351 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	59,767,092 - 59,881,753 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	65,159,944 - 65,275,408 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	65,159,944 - 65,275,408 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	65,375,936 - 65,490,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	59,638,555 - 59,753,791 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	59,659,284 - 59,774,521 (-)	NCBI
Celera	7	52,634,133 - 52,748,501 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Birth Weight (ISO)

disease of cellular proliferation (ISO)

genetic disease (ISO)

Hamartoma (ISO)

leiomyoma (ISO)

lipoma (ISO)

Neoplasm Invasiveness (ISO)

obesity (ISO)

ovarian cancer (ISO)

Silver-Russell Syndrome 1 (ISO)

Silver-Russell Syndrome 5 (ISO)

uterine fibroid (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO)

2-deoxy-D-glucose (ISO)

2-methoxyethanol (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methyladenine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-nitrophenol (ISO)

4-phenylbutyric acid (ISO)

5-azacytidine (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cadmium sulfate (ISO)

caffeine (ISO)

cannabidiol (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

crotonaldehyde (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

deguelin (ISO)

dexamethasone (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethyl methanesulfonate (ISO)

etoposide (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

hypochlorous acid (ISO)

indometacin (ISO)

itraconazole (ISO)

ivermectin (ISO)

ketoconazole (ISO)

L-methionine (ISO)

lead(0) (ISO)

maneb (ISO)

melphalan (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

mitomycin C (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (ISO)

N-acetyl-L-cysteine (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

permethrin (ISO)

phenobarbital (EXP)

pirinixic acid (EXP)

piroxicam (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

quercitrin (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tebufenpyrad (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

topotecan (ISO)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adipose tissue development (ISO)

adrenal gland development (ISO)

astrocyte differentiation (ISO)

base-excision repair (ISO,ISS)

cell population proliferation (ISO)

cell proliferation in forebrain (ISO)

chondrocyte differentiation (ISO,ISS)

chondrocyte proliferation (ISO,ISS)

endodermal cell differentiation (ISO,ISS)

epithelial to mesenchymal transition (ISO,ISS)

epithelial tube branching involved in lung morphogenesis (ISO)

fat cell differentiation (ISO,ISS)

fat pad development (ISO)

fibroblast proliferation (ISO)

heterochromatin formation (ISO,ISS)

intracellular signal transduction (ISO,ISS)

lung epithelium development (ISO)

male gonad development (ISO)

mesenchymal cell differentiation (ISO,ISS)

mesodermal cell differentiation (ISO,ISS)

mesodermal-endodermal cell signaling (ISO,ISS)

multicellular organism growth (ISO)

negative regulation by host of viral transcription (ISO,ISS)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of astrocyte differentiation (ISO)

negative regulation of cellular senescence (ISO)

negative regulation of DNA-templated transcription (ISO,ISS)

negative regulation of double-strand break repair via nonhomologous end joining (ISO,ISS)

negative regulation of intracellular steroid hormone receptor signaling pathway (IDA)

negative regulation of receptor signaling pathway via JAK-STAT (IDA)

negative regulation of single stranded viral RNA replication via double stranded DNA intermediate (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IDA,ISO,ISS)

negative regulation of Wnt signaling pathway (ISO)

oncogene-induced cell senescence (ISO,ISS)

pituitary gland development (ISO)

positive regulation of angiogenesis (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of cell proliferation in bone marrow (ISO)

positive regulation of DNA-binding transcription factor activity (IMP)

positive regulation of DNA-templated transcription (ISO)

positive regulation of epithelial cell proliferation involved in lung morphogenesis (ISO)

positive regulation of fibroblast proliferation (ISO)

positive regulation of gene expression (ISO,ISS)

positive regulation of multicellular organism growth (ISO)

positive regulation of stem cell proliferation (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

regulation of cell cycle process (ISO,ISS)

regulation of DNA-templated transcription (IBA,ISO,ISS)

regulation of growth hormone secretion (ISO)

regulation of peptide hormone secretion (ISO)

regulation of stem cell population maintenance (ISO,ISS)

response to virus (ISO)

somatic stem cell population maintenance (ISO)

spermatogenesis (ISO)

stem cell differentiation (ISO)

stem cell proliferation (ISO)

Cellular Component

male germ cell nucleus (ISO)

nuclear chromosome (ISO,ISS)

nucleus (IBA,ISO,ISS)

protein-DNA complex (ISO,ISS)

senescence-associated heterochromatin focus (ISO,ISS)

SMAD protein complex (ISO,ISS)

Molecular Function

5'-deoxyribose-5-phosphate lyase activity (ISO,ISS)

C2H2 zinc finger domain binding (ISO,ISS)

cAMP response element binding (ISO,ISS)

DNA binding, bending (ISO,ISS)

DNA-(apurinic or apyrimidinic site) endonuclease activity (ISO,ISS)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

enzyme binding (IPI)

MH1 domain binding (ISO,ISS)

MH2 domain binding (ISO,ISS)

minor groove of adenine-thymine-rich DNA binding (ISO,ISS)

nucleic acid binding (ISO)

nucleosomal DNA binding (ISO,ISS)

protein binding (ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

SMAD binding (ISO)

transcription cis-regulatory region binding (ISO,ISS)

transcription coregulator activity (IBA)

transcription corepressor activity (ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

Ras mediated signaling pathway (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	In vivo modulation of Hmgic reduces obesity.	Anand A and Chada K, Nat Genet. 2000 Apr;24(4):377-80.
2.	Disruption of the architectural factor HMGI-C: DNA-binding AT hook motifs fused in lipomas to distinct transcriptional regulatory domains.	Ashar HR, etal., Cell. 1995 Jul 14;82(1):57-65.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Fusion transcripts between the HMGIC gene and RTVL-H-related sequences in mesenchymal tumors without cytogenetic aberrations.	Kazmierczak B, etal., Genomics. 1996 Dec 1;38(2):223-6.
5.	Oncogenic raf-1 induces the expression of non-histone chromosomal architectural protein HMGI-C via a p44/p42 mitogen-activated protein kinase-dependent pathway in salivary epithelial cells.	Li D, etal., J Biol Chem 1997 Oct 3;272(40):25062-70.
6.	HMGA2 gene is a promising target for ovarian cancer silencing therapy.	Malek A, etal., Int J Cancer. 2008 Jul 15;123(2):348-56.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Neoplastic transformation of rat thyroid cells requires the junB and fra-1 gene induction which is dependent on the HMGI-C gene product.	Vallone D, etal., EMBO J. 1997 Sep 1;16(17):5310-21.
13.	Requirement for high mobility group protein HMGI-C interaction with STAT3 inhibitor PIAS3 in repression of alpha-subunit of epithelial Na+ channel (alpha-ENaC) transcription by Ras activation in salivary epithelial cells.	Zentner MD, etal., J Biol Chem. 2001 Aug 10;276(32):29805-14. Epub 2001 Jun 4.

Additional References at PubMed

PMID:504232	PMID:5051369	PMID:7651535	PMID:7958830	PMID:11555636	PMID:12032866	PMID:14627817	PMID:14645522	PMID:14668482	PMID:14794889	PMID:15225648	PMID:15645138
PMID:15755872	PMID:16061642	PMID:16109425	PMID:16791210	PMID:16901784	PMID:17005673	PMID:17078040	PMID:17305714	PMID:17324944	PMID:17426251	PMID:17624332	PMID:17854662
PMID:18640244	PMID:18832382	PMID:18957199	PMID:19465398	PMID:19549901	PMID:20108983	PMID:21484705	PMID:21533145	PMID:23072816	PMID:24661562	PMID:25557289	PMID:25623534
PMID:26698218	PMID:27693697	PMID:30934671	PMID:32068957	PMID:32370714	PMID:33749722	PMID:35966335

Genomics

Comparative Map Data

Hmga2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	57,762,710 - 57,884,555 (-)	NCBI		GRCr8
mRatBN7.2	7	55,877,145 - 55,998,813 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	55,880,112 - 55,994,784 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	57,786,495 - 57,901,148 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	59,989,707 - 60,104,351 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	59,767,092 - 59,881,753 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	65,159,944 - 65,275,408 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	65,159,944 - 65,275,408 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	65,375,936 - 65,490,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	59,638,555 - 59,753,791 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	59,659,284 - 59,774,521 (-)	NCBI
Celera	7	52,634,133 - 52,748,501 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

HMGA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	65,824,460 - 65,966,291 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	65,824,460 - 65,966,291 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	66,218,240 - 66,360,071 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	64,504,507 - 64,646,338 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	64,504,457 - 64,646,266	NCBI
Celera	12	65,883,845 - 66,025,902 (+)	NCBI		Celera
Cytogenetic Map	12	q14.3	NCBI
HuRef	12	63,271,242 - 63,413,086 (+)	NCBI		HuRef
CHM1_1	12	66,185,507 - 66,327,350 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	65,803,963 - 65,945,820 (+)	NCBI		T2T-CHM13v2.0

Hmga2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	120,197,173 - 120,312,374 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	120,197,180 - 120,312,374 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	120,361,268 - 120,476,469 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	120,361,275 - 120,476,469 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	119,798,331 - 119,913,991 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	119,764,721 - 119,880,028 (-)	NCBI		MGSCv36	mm8
Celera	10	122,723,179 - 122,838,757 (-)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	67.94	NCBI

Hmga2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955458	12,493,790 - 12,624,805 (+)	NCBI	ChiLan1.0	ChiLan1.0

HMGA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	28,400,118 - 28,548,065 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	28,396,888 - 28,538,621 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	22,954,946 - 23,096,623 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

HMGA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	8,348,101 - 8,491,435 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	8,278,957 - 8,424,016 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	8,459,176 - 8,604,625 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	8,459,180 - 8,601,880 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	8,335,596 - 8,480,987 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	8,581,865 - 8,727,080 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	8,703,471 - 8,848,741 (+)	NCBI		UU_Cfam_GSD_1.0

Hmga2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	50,151,774 - 50,166,701 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936545	3,944,419 - 4,064,193 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936545	3,944,419 - 3,958,289 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HMGA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	5	30,188,521 - 30,329,635 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	33,375,397 - 33,516,455 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HMGA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	61,509,114 - 61,655,633 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	184,069,350 - 184,211,090 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hmga2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	2,337,464 - 2,467,990 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624802	2,337,344 - 2,468,757 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hmga2
443 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	55
Count of miRNA genes:	51
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000065137
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	41109692	56793354	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	47251783	65728867	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		14	10	10		10			16	16	18
Low	2	10	22	12	9	12			31	6	16
Below cutoff	1	8	8	6	3	6	1	1	12	11	7	1	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_032070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF261719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U89695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000065137 ⟹ ENSRNOP00000061041

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	55,880,112 - 55,994,784 (-)	Ensembl
Rnor_6.0 Ensembl	7	65,159,944 - 65,275,408 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103543 ⟹ ENSRNOP00000084064

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	55,980,980 - 55,994,784 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000120053 ⟹ ENSRNOP00000085277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	55,991,273 - 55,994,784 (-)	Ensembl

RefSeq Acc Id:

NM_032070 ⟹ NP_114459

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	57,765,675 - 57,880,341 (-)	NCBI
mRatBN7.2	7	55,880,112 - 55,994,784 (-)	NCBI
Rnor_6.0	7	65,159,944 - 65,275,408 (-)	NCBI
Rnor_5.0	7	65,375,936 - 65,490,635 (-)	NCBI
RGSC_v3.4	7	59,638,555 - 59,753,791 (-)	RGD
Celera	7	52,634,133 - 52,748,501 (-)	RGD

Sequence:

show sequence

AACTCCCGAGCCGTAGCGGAGAGAGGAACCCTCTCCACCTCCAACTCTCCCTCTCCCTCGCTTC
CCGCCTCTCGCTACCTCCACCTCCACCTCCACCTCCGCCACCCACCGCCCGCAGCCCCTCCTCC
TTTCCTCCTCCTTTCCTCCTCCTCTCCTCCTCCTCCACTCTTCCTCCCTCCCCTCTCTCTTTTT
GGCAGCTGCTGGACGTCCGGTGTTGGTGGTGGCAGCGGCGGCAGCCTAAGCAGCAGCAGCCCCC
AGCGCGCGCCAGCTCGCCCGCTCTCGCCGCCCCTGCCCTCTCCAGCTCTCTCCATCCCGTCTCC
CGAAAGGTGTTGGGCGGATCCGAGGCAGCGGAGGCCGAGCGGCTGCAGCGGCGGTACCGGCGGA
GGCAGCGGTAGCGGCGGCGGGAGGCAGGATGAGCGCACGCGGTGAGGGCGCCGGGCAGCCGTCC
ACATCAGCCCAGGGACAACCTGCCACCCCGGCGCCACAGAAGCGAGGACGCGGCCGACCCAGGA
AGCAGCCGCAAGAGCCAACCTGTGAGCCCTCTCCTAAGAGACCCAGAGGAAGACCCAAAGGCAG
CAAGAACAAGAGCCCCTCGAAAGCAGCTCAAAAGAAAGCAGAGACCATTGGAGAAAAACGGCCA
AGAGGCAGACCCAGGAAATGGCCACAACAAATTGTTCAGAAGCCTGCTCAGGAGACTGAAGAGA
CATCCTCGCAAGAGTCCGCAGAGGAAGATTAGGGGGCGCCGACATTCAATTTCTACCTCAGCAT
CAGTTTGATCTTTCGAAGGGAGAAGACACTGCAG

hide sequence

RefSeq Acc Id:

XM_039079971 ⟹ XP_038935899

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	57,762,710 - 57,884,555 (-)	NCBI
mRatBN7.2	7	55,877,145 - 55,998,813 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_114459	(Get FASTA)	NCBI Sequence Viewer
	XP_038935899	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC25950	(Get FASTA)	NCBI Sequence Viewer
	AAF91385	(Get FASTA)	NCBI Sequence Viewer
	EDM16566	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061041
	ENSRNOP00000061041.2
	ENSRNOP00000084064.1
	ENSRNOP00000085277.1

RefSeq Acc Id:	NP_114459 ⟸ NM_032070
- UniProtKB:	O88791 (UniProtKB/TrEMBL), F1M940 (UniProtKB/TrEMBL), A0A9K3Y850 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSARGEGAGQPSTSAQGQPATPAPQKRGRGRPRKQPQEPTCEPSPKRPRGRPKGSKNKSPSKAA QKKAETIGEKRPRGRPRKWPQQIVQKPAQETEETSSQESAEED hide sequence

RefSeq Acc Id:

ENSRNOP00000061041 ⟸ ENSRNOT00000065137

RefSeq Acc Id:	XP_038935899 ⟸ XM_039079971
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000084064 ⟸ ENSRNOT00000103543

RefSeq Acc Id:

ENSRNOP00000085277 ⟸ ENSRNOT00000120053

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88791-F1-model_v2	AlphaFold	O88791	1-107	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695235

Promoter ID:

EPDNEW_R5760

Type:

initiation region

Name:

Hmga2_1

Description:

high mobility group AT-hook 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	65,275,414 - 65,275,474	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620617	AgrOrtholog
BioCyc Gene	G2FUF-33911	BioCyc
Ensembl Genes	ENSRNOG00000042460	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065137	ENTREZGENE
	ENSRNOT00000065137.3	UniProtKB/TrEMBL
	ENSRNOT00000103543.1	UniProtKB/TrEMBL
	ENSRNOT00000120053.1	UniProtKB/TrEMBL
InterPro	AT_hook_DNA-bd_motif	UniProtKB/TrEMBL
	HMGI/HMGY	UniProtKB/TrEMBL
	HMGI/Y_DNA-bd_CS	UniProtKB/TrEMBL
KEGG Report	rno:84017	UniProtKB/TrEMBL
NCBI Gene	84017	ENTREZGENE
PANTHER	HIGH MOBILITY GROUP AT-HOOK 2	UniProtKB/TrEMBL
	HIGH MOBILITY GROUP PROTEIN HMGI-C	UniProtKB/TrEMBL
	HIGH MOBILITY GROUP PROTEINS HMG-A AND C	UniProtKB/TrEMBL
Pfam	AT_hook	UniProtKB/TrEMBL
PhenoGen	Hmga2	PhenoGen
PRINTS	ATHOOK	UniProtKB/TrEMBL
	HIGHMOBLTYIY	UniProtKB/TrEMBL
PROSITE	HMGI_Y	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000042460	RatGTEx
SMART	AT_hook	UniProtKB/TrEMBL
UniProt	A0A8I6A172_RAT	UniProtKB/TrEMBL
	A0A8I6GCP7_RAT	UniProtKB/TrEMBL
	A0A9K3Y850	ENTREZGENE, UniProtKB/TrEMBL
	F1M940	ENTREZGENE
	O88791	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1M940	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Hmga2	high mobility group AT-hook 2	Hmgic	non-histone chromosomal architectural protein HMGI-C	Symbol and Name updated	1299863	APPROVED
2002-08-07	Hmgic	non-histone chromosomal architectural protein HMGI-C			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	transcription is activated by oncogenic Raf-1 kinase	632948

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations