Advanced Search (OLGA)

Gene: Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha) Rattus norvegicus

Analyze

Symbol:

Pi4k2a

Name:

phosphatidylinositol 4-kinase type 2 alpha

RGD ID:

620485

Description:

Enables 1-phosphatidylinositol 4-kinase activity. Involved in basophil degranulation. Located in several cellular components, including cytoplasmic vesicle membrane; growing cell tip; and perikaryon. Part of protein-containing complex. Orthologous to human PI4K2A (phosphatidylinositol 4-kinase type 2 alpha); PARTICIPATES IN Wnt signaling, canonical pathway; inositol phosphate metabolic pathway; phosphatidylinositol 3-kinase signaling pathway; INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

55 kDa type II phosphatidylinositol 4-kinase; phosphatidylinositol 4-kinase type 2-alpha; phosphatidylinositol 4-kinase type II; phosphatidylinositol 4-kinase type II-alpha; Pi4KII

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPL37 (ribosomal protein L37)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PI4K2A (phosphatidylinositol 4-kinase type 2 alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pi4k2a (phosphatidylinositol 4-kinase type 2 alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C56A3.8	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	LSB6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pi4KIIalpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZC8.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pi4k2a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pi4k2a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Rf1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	250,850,440 - 250,878,399 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	250,852,154 - 250,881,811 (+)	Ensembl				GRCr8
mRatBN7.2	1	240,902,804 - 240,929,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	240,902,855 - 240,929,337 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	249,048,304 - 249,074,558 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	255,745,447 - 255,771,702 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	248,398,475 - 248,424,733 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	261,337,594 - 261,362,509 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	261,337,594 - 261,362,509 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	268,790,066 - 268,814,981 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	248,736,384 - 248,760,679 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	236,737,388 - 236,761,684 (+)	NCBI		Celera
RGSC_v3.1	1	248,995,210 - 249,019,506 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

NEURODEVELOPMENTAL DISORDER WITH HYPERKINETIC MOVEMENTS, SEIZURES, AND STRUCTURAL BRAIN ABNORMALITIES (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

acetamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

avobenzone (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

camptothecin (ISO)

CGP 52608 (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

flavonoids (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

ivermectin (ISO)

methyl methanesulfonate (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

temozolomide (ISO)

thimerosal (ISO)

thiram (ISO)

titanium dioxide (ISO)

uranium atom (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basophil degranulation (IMP)

endosome organization (IBA)

Golgi organization (IBA)

lipid metabolic process (IEA)

phosphatidylinositol biosynthetic process (IEA,ISO,ISS)

phosphatidylinositol phosphate biosynthetic process (IBA,IEA,ISO)

Cellular Component

BLOC-1 complex (IEA,ISO,ISS)

cytoplasmic vesicle (IDA,IEA)

dendrite (IEA,ISO,ISS)

early endosome membrane (IDA,IEA,ISO)

endosome (IBA,IDA,IEA)

endosome membrane (IEA,ISO)

exocytic vesicle (IDA)

glutamatergic synapse (IEA,ISO)

Golgi apparatus (IEA)

Golgi membrane (IEA,ISO)

growing cell tip (IDA)

membrane (IEA,ISO,ISS)

membrane raft (IEA,ISO)

mitochondrion (IEA,ISO,ISS)

neuron projection (IDA,IEA,ISO)

neuronal cell body (IDA,IEA,ISO,ISS)

perikaryon (IDA,IEA)

plasma membrane (IBA,IEA,ISO,ISS)

presynaptic active zone (IEA,ISO)

presynaptic membrane (IEA,ISO,ISS)

protein-containing complex (IDA)

synapse (IEA)

synaptic vesicle membrane (IDA)

trans-Golgi network (IBA)

Molecular Function

1-phosphatidylinositol 4-kinase activity (IBA,IDA,IEA,ISO)

AP-3 adaptor complex binding (IEA,ISO,ISS)

ATP binding (IEA,ISO,ISS)

kinase activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

protein-containing complex binding (IDA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

inositol phosphate metabolic pathway (IEA)

phosphatidylinositol 3-kinase signaling pathway (IEA)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A novel family of phosphatidylinositol 4-kinases conserved from yeast to humans.	Barylko B, etal., J Biol Chem 2001 Mar 16;276(11):7705-8.
2.	Analysis of the catalytic domain of phosphatidylinositol 4-kinase type II.	Barylko B, etal., J Biol Chem 2002 Nov 15;277(46):44366-75.
3.	Phosphatidylinositol-4-kinase type II alpha contains an AP-3-sorting motif and a kinase domain that are both required for endosome traffic.	Craige B, etal., Mol Biol Cell. 2008 Apr;19(4):1415-26. Epub 2008 Feb 6.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Phosphatidylinositol 4-kinase type IIalpha is responsible for the phosphatidylinositol 4-kinase activity associated with synaptic vesicles.	Guo J, etal., Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3995-4000. Epub 2003 Mar 19.
6.	The role of phosphatidylinositol 4-kinase type IIalpha in degranulation of RBL-2H3 cells.	Ishihara Y, etal., Inflamm Res. 2006 Nov;55(11):465-8.
7.	The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.	Larimore J, etal., Mol Biol Cell. 2011 Dec;22(24):4854-67. doi: 10.1091/mbc.E11-07-0592. Epub 2011 Oct 12.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	BLOC-1 complex deficiency alters the targeting of adaptor protein complex-3 cargoes.	Salazar G, etal., Mol Biol Cell. 2006 Sep;17(9):4014-26. Epub 2006 Jun 7.
15.	Attenuation of amyloid beta (Abeta)-induced inhibition of phosphatidylinositol 4-kinase activity by Abeta fragments, Abeta20-29 and Abeta31-35.	Wu B, etal., Neurosci Lett. 2006 Mar 27;396(2):148-52. Epub 2005 Dec 13.

Additional References at PubMed

PMID:11279162	PMID:12471042	PMID:15944223	PMID:17897319	PMID:19946888	PMID:23146885	PMID:24675427	PMID:25168678	PMID:32463939

Genomics

Comparative Map Data

Pi4k2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	250,850,440 - 250,878,399 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	250,852,154 - 250,881,811 (+)	Ensembl				GRCr8
mRatBN7.2	1	240,902,804 - 240,929,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	240,902,855 - 240,929,337 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	249,048,304 - 249,074,558 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	255,745,447 - 255,771,702 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	248,398,475 - 248,424,733 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	261,337,594 - 261,362,509 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	261,337,594 - 261,362,509 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	268,790,066 - 268,814,981 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	248,736,384 - 248,760,679 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	236,737,388 - 236,761,684 (+)	NCBI		Celera
RGSC_v3.1	1	248,995,210 - 249,019,506 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

PI4K2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	97,640,671 - 97,676,434 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	97,640,671 - 97,676,757 (+)	Ensembl			hg38	GRCh38
GRCh37	10	99,400,428 - 99,436,191 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	99,390,433 - 99,426,177 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	10	93,137,746 - 93,173,496 (+)	NCBI		Celera
Cytogenetic Map	10	q24.2	NCBI
HuRef	10	93,026,125 - 93,061,814 (+)	NCBI		HuRef
CHM1_1	10	99,682,196 - 99,717,943 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	98,520,873 - 98,556,635 (+)	NCBI		T2T-CHM13v2.0

Pi4k2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	42,078,590 - 42,110,657 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	42,078,909 - 42,110,526 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	42,090,148 - 42,122,218 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	42,090,470 - 42,122,087 (+)	Ensembl			mm10	GRCm38
MGSCv37	19	42,164,925 - 42,196,708 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	42,143,746 - 42,175,529 (+)	NCBI		MGSCv36	mm8
Celera	19	42,894,069 - 42,920,028 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	35.74	NCBI

Pi4k2a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955507	3,730,071 - 3,756,880 (+)	Ensembl
ChiLan1.0	NW_004955507	3,729,947 - 3,761,703 (+)	NCBI	ChiLan1.0	ChiLan1.0

PI4K2A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	109,552,631 - 109,584,525 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	109,557,944 - 109,590,610 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	94,261,096 - 94,293,358 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	97,753,860 - 97,788,054 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

PI4K2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	10,890,654 - 10,921,898 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	10,720,094 - 10,930,286 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	11,075,666 - 11,106,919 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	11,215,885 - 11,247,161 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	11,215,161 - 11,247,156 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	10,901,119 - 10,932,268 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	10,937,530 - 10,968,779 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	11,077,372 - 11,108,650 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pi4k2a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	36,015,706 - 36,044,485 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936636	2,053,826 - 2,083,633 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936636	2,054,672 - 2,083,580 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PI4K2A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	109,008,161 - 109,043,515 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	109,008,143 - 109,043,517 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	118,512,193 - 118,545,324 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PI4K2A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	90,805,197 - 90,840,047 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	90,805,086 - 90,834,730 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	51,701,959 - 51,739,002 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pi4k2a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	9,271,546 - 9,308,180 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	9,271,519 - 9,309,843 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pi4k2a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	41,205,864 - 41,233,909 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pi4k2a
230 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	69
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000019874
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	238398865	255849249	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

BE097981

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	240,918,700 - 240,918,872 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	261,353,759 - 261,353,930	NCBI	Rnor6.0
Rnor_5.0	1	268,806,231 - 268,806,402	UniSTS	Rnor5.0
RGSC_v3.4	1	248,744,666 - 248,744,837	UniSTS	RGSC3.4
Celera	1	236,753,236 - 236,753,407	UniSTS
RH 3.4 Map	1	1618.32	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC131867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY029199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019874 ⟹ ENSRNOP00000019874

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	250,852,154 - 250,881,811 (+)	Ensembl
mRatBN7.2 Ensembl	1	240,902,855 - 240,927,155 (+)	Ensembl
Rnor_6.0 Ensembl	1	261,337,594 - 261,362,509 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095169 ⟹ ENSRNOP00000094624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	250,852,154 - 250,878,399 (+)	Ensembl
mRatBN7.2 Ensembl	1	240,902,855 - 240,929,337 (+)	Ensembl

RefSeq Acc Id:

NM_053735 ⟹ NP_446187

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	250,852,154 - 250,878,399 (+)	NCBI
mRatBN7.2	1	240,902,855 - 240,929,105 (+)	NCBI
Rnor_6.0	1	261,337,594 - 261,362,509 (+)	NCBI
Rnor_5.0	1	268,790,066 - 268,814,981 (+)	NCBI
RGSC_v3.4	1	248,736,384 - 248,760,679 (-)	RGD
Celera	1	236,737,388 - 236,761,684 (+)	RGD

Sequence:

show sequence

GAACTCCCGGTAGGTGGTTCCCGAGCGCGCCGGGTTCCCGAGCCGGCGGTCTGAGGGATGGACG
AGACGAGCCCGCTAGTGTCCCCCGAGCGGGCCCAACCCCCTGAGTACACCTTCCCGTCGGTCTC
GGGAGCTCACTTTCCGCAGGTACCGGGGGGCGCGGTCCGCGTAGCGGCGGCCGGCTCCGGCCCG
TCCCCGCCGTGCTCTCCGGGCCACGACCGGGAGCGGCAGCCCCTGCTGGACCGGGCCCGGGGCG
CGGCGGCGCAGGGTCAGACCCACACGGTGGCGGCGCAGGCCCAGGCCCTGGCCGCCCAGGCGGC
CGTGGCGGTGCACGCCGTTCAGACCCACCGCGAGCGAAACGACTTCCCGGAGGACCCCGAGTTC
GAGGTGGTGGTGCGGCAGGCCGAGATAGCCATCGAGTGCAGCATCTATCCCGAGCGCATCTACC
AGGGCTCCAGTGGAAGCTACTTCGTCAAGGACTCTCAGGGGAGGATCATTGCTGTCTTCAAACC
CAAGAATGAAGAGCCATACGGGAACCTTAACCCTAAGTGGACCAAATGGCTTCAGAAGCTGTGC
TGCCCCTGCTGCTTTGGCCGAGATTGCCTTGTTCTCAACCAGGGCTATCTCTCAGAAGCAGGGG
CTAGCCTGGTGGACCAAAAACTGGAACTCAACATTGTACCCCGTACAAAGGTAGTATACCTGGC
CAGTGAAACCTTCAACTATAGTGCCATTGACCGAGTAAAGTCCAGGGGCAAGCGACTTGCACTA
GAGAAAGTGCCAAAAGTTGGGCAGCGGTTTAACCGCATTGGGCTACCACCAAAGGTCGGGTCAT
TCCAGCTCTTTGTTGAAGGCTACAAAGATGCAGACTATTGGCTACGGCGTTTTGAAGCAGAACC
TCTTCCCGAGAACACGAACCGACAGCTACTATTGCAGTTTGAGCGGTTGGTGGTCCTGGACTAC
ATCATCCGCAACACTGACCGAGGCAATGACAACTGGTTGATCAAATATGACTATCCGATGGATA
ATCCTAACTGTCGGGACACAGACTGGGTGATGGTGAGGGAGCCTGTTATCAAGGTGGCCGCCAT
AGACAATGGACTGGCTTTCCCACTGAAGCACCCTGACTCCTGGAGGGCATATCCTTTTTACTGG
GCCTGGTTGCCACAGGCTAAAGTCCCATTCTCTCAGGAGATCAAAGATTTGATTCTTCCAAAGA
TTTCAGACCCTAACTTCGTCAAGGACTTGGAGGAGGACCTATATGAACTCTTCAAGAAAGATCC
TGGTTTCGACAGGGGCCAGTTCCATAAGCAGATTGCTGTCATGAGAGGTCAGATCCTAAATTTG
ACCCAGGCCCTAAAAGACAATAAGAGTCCCCTGCACCTCGTCCAGATGCCACCCGTGATTGTTG
AGACGGCCCGTTCTCATCAGCGGTCTTCAAGTGAATCCTACACACAGAGCTTCCAGAGTCGGAA
GCCCTTCTTTTCATGGTGGTAGCCCAGAGGCAGGCAGGCAGAAGAAATCCTGCAGGTGACAGGC
TGGGAGAAAGCCTGGAGACCCAGGTTCCAGGAAGCCAGAGAAGTTGGTGCACAGCAGAGCCTTT
CAGAGCCCTTCCTCTTTGCT

hide sequence

RefSeq Acc Id:

XM_039108036 ⟹ XP_038963964

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	250,850,440 - 250,878,399 (+)	NCBI
mRatBN7.2	1	240,902,804 - 240,929,234 (+)	NCBI

RefSeq Acc Id:

XM_039108091 ⟹ XP_038964019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	250,850,440 - 250,877,600 (+)	NCBI
mRatBN7.2	1	240,902,805 - 240,928,306 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446187	(Get FASTA)	NCBI Sequence Viewer
	XP_038963964	(Get FASTA)	NCBI Sequence Viewer
	XP_038964019	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK33002	(Get FASTA)	NCBI Sequence Viewer
	EDL94229	(Get FASTA)	NCBI Sequence Viewer
	EDL94230	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019874.1
	ENSRNOP00000094624
GenBank Protein	Q99M64	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446187 ⟸ NM_053735

- UniProtKB:

Q99M64 (UniProtKB/Swiss-Prot), A6JHA5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDETSPLVSPERAQPPEYTFPSVSGAHFPQVPGGAVRVAAAGSGPSPPCSPGHDRERQPLLDRA
RGAAAQGQTHTVAAQAQALAAQAAVAVHAVQTHRERNDFPEDPEFEVVVRQAEIAIECSIYPER
IYQGSSGSYFVKDSQGRIIAVFKPKNEEPYGNLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSE
AGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKV
GSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDYP
MDNPNCRDTDWVMVREPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLIL
PKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPV
IVETARSHQRSSSESYTQSFQSRKPFFSWW

hide sequence

Ensembl Acc Id:

ENSRNOP00000019874 ⟸ ENSRNOT00000019874

RefSeq Acc Id:	XP_038963964 ⟸ XM_039108036
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GL94 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038964019 ⟸ XM_039108091
- Peptide Label:	isoform X2
- UniProtKB:	Q99M64 (UniProtKB/Swiss-Prot), A6JHA5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094624 ⟸ ENSRNOT00000095169

Protein Domains

PI3K/PI4K catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99M64-F1-model_v2	AlphaFold	Q99M64	1-478	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690915

Promoter ID:

EPDNEW_R1440

Type:

initiation region

Name:

Pi4k2a_1

Description:

phosphatidylinositol 4-kinase type 2 alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	261,337,598 - 261,337,658	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620485	AgrOrtholog
BioCyc Gene	G2FUF-55660	BioCyc
BioCyc Pathway	PWY-6351 [D-myo-inositol (1,4,5)-trisphosphate biosynthesis]	BioCyc
	PWY-6352 [3-phosphoinositide biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6351	BioCyc
	PWY-6352	BioCyc
Ensembl Genes	ENSRNOG00000014675	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019874.3	UniProtKB/Swiss-Prot
	ENSRNOT00000095169	ENTREZGENE
InterPro	Lsb6/PI4K2	UniProtKB/Swiss-Prot
	PI3/4_kinase_cat_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:114554	UniProtKB/Swiss-Prot
NCBI Gene	114554	ENTREZGENE
PANTHER	PHOSPHATIDYLINOSITOL 4-KINASE TYPE 2-ALPHA	UniProtKB/Swiss-Prot
	PTHR12865	UniProtKB/Swiss-Prot
Pfam	PI3_PI4_kinase	UniProtKB/Swiss-Prot
PhenoGen	Pi4k2a	PhenoGen
PROSITE	PI3_4_KINASE_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014675	RatGTEx
Superfamily-SCOP	ADP-ribosylation	UniProtKB/Swiss-Prot
UniProt	A0A8I6GL94	ENTREZGENE, UniProtKB/TrEMBL
	A6JHA5	ENTREZGENE, UniProtKB/TrEMBL
	A6JHA6_RAT	UniProtKB/TrEMBL
	P4K2A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-01-30	Pi4k2a	phosphatidylinositol 4-kinase type 2 alpha	Pi4KII		Data merged from RGD:1354667	737654	APPROVED
2005-01-20	Pi4k2a	phosphatidylinositol 4-kinase type 2 alpha	Pi4KII	phosphatidylinositol 4-kinase type II	Symbol and Name updated	1299863	APPROVED
2002-08-07	Pi4KII	phosphatidylinositol 4-kinase type II			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	enriched in lipid rafts	633909
gene_protein	catalytic domain relatively resistant to digestion, but eventually cleaved into 2 fragments of 17 and 26 kDa	633909
gene_regulation	enzyme activity inhibited by adenosine, but insensitive to wortmannin	633909

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways