Symbol:
Ppig
Name:
peptidylprolyl isomerase G
RGD ID:
620315
Description:
Enables peptidyl-prolyl cis-trans isomerase activity. Predicted to be involved in protein folding. Located in nuclear matrix. Orthologous to human PPIG (peptidylprolyl isomerase G); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cyclophilin G; matrin cyclophilin (matrin-cyp); matrin-cyp; peptidyl-prolyl cis-trans isomerase G; peptidyl-prolyl isomerase G; PPIase G; rotamase G
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPIG (peptidylprolyl isomerase G) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ppig (peptidyl-prolyl isomerase G (cyclophilin G)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppig (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPIG (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPIG (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppig (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPIG (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPIG (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppig (peptidylprolyl isomerase G) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
H1-6 (H1.6 linker histone, cluster member) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PPIG (peptidylprolyl isomerase G)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ppig (peptidyl-prolyl isomerase G (cyclophilin G))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppig (peptidylprolyl isomerase G (cyclophilin G))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Moca-cyp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cyn-8
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cyn-9
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 74,891,846 - 74,923,010 (+) NCBI GRCr8 mRatBN7.2 3 54,484,023 - 54,512,929 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 54,484,023 - 54,512,926 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 57,884,329 - 57,913,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 66,467,923 - 66,496,924 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 64,230,295 - 64,259,295 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 55,960,067 - 55,988,968 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 51,866,989 - 51,895,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 51,763,360 - 51,792,262 (+) NCBI Celera 3 54,044,534 - 54,073,434 (+) NCBI Celera Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppig Rat 1,2-dimethylhydrazine multiple interactions ISO Ppig (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PPIG mRNA CTD PMID:22206623 Ppig Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppig (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPIG mRNA CTD PMID:18691609 Ppig Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PPIG mRNA CTD PMID:34747641 Ppig Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PPIG mRNA CTD PMID:21346803 Ppig Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PPIG mRNA CTD PMID:21346803 Ppig Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ppig (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PPIG mRNA CTD PMID:26251327 Ppig Rat 4,4'-sulfonyldiphenol increases expression ISO Ppig (Mus musculus) 6480464 bisphenol S results in increased expression of PPIG mRNA CTD PMID:39298647 Ppig Rat 4,4'-sulfonyldiphenol decreases methylation ISO PPIG (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PPIG gene CTD PMID:31601247 Ppig Rat acetylsalicylic acid increases expression ISO PPIG (Homo sapiens) 6480464 Aspirin results in increased expression of PPIG mRNA CTD PMID:15928584 Ppig Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of PPIG protein CTD PMID:34896426 Ppig Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PPIG mRNA CTD PMID:38685447 Ppig Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPIG mRNA CTD PMID:16483693 Ppig Rat antirheumatic drug increases expression ISO PPIG (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PPIG mRNA CTD PMID:24449571 Ppig Rat aristolochic acid A decreases expression ISO PPIG (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PPIG mRNA CTD PMID:33212167 Ppig Rat arsenous acid increases expression ISO PPIG (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPIG mRNA CTD PMID:20458559 Ppig Rat asbestos affects expression ISO PPIG (Homo sapiens) 6480464 Asbestos affects the expression of PPIG mRNA CTD PMID:17297452 Ppig Rat benzo[a]pyrene multiple interactions ISO Ppig (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PPIG mRNA CTD PMID:27858113 Ppig Rat benzo[a]pyrene decreases methylation ISO PPIG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PPIG promoter CTD PMID:27901495 Ppig Rat benzo[a]pyrene diol epoxide I decreases expression ISO PPIG (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Ppig Rat benzo[b]fluoranthene multiple interactions ISO Ppig (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PPIG mRNA CTD PMID:27858113 Ppig Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPIG mRNA CTD PMID:25181051 and PMID:30816183 Ppig Rat bisphenol A decreases expression ISO Ppig (Mus musculus) 6480464 bisphenol A results in decreased expression of PPIG mRNA CTD PMID:33221593 Ppig Rat bisphenol AF increases expression ISO PPIG (Homo sapiens) 6480464 bisphenol AF results in increased expression of PPIG protein CTD PMID:34186270 Ppig Rat cadmium dichloride decreases expression ISO PPIG (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat caffeine affects phosphorylation ISO PPIG (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PPIG protein CTD PMID:35688186 Ppig Rat carbon nanotube decreases expression ISO Ppig (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PPIG mRNA CTD PMID:25554681 Ppig Rat chloroacetaldehyde decreases expression ISO PPIG (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of PPIG mRNA CTD PMID:23125180 Ppig Rat chlorpyrifos decreases expression ISO Ppig (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PPIG mRNA CTD PMID:37019170 Ppig Rat chrysene multiple interactions ISO Ppig (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PPIG mRNA CTD PMID:27858113 Ppig Rat cidofovir anhydrous decreases expression ISO PPIG (Homo sapiens) 6480464 Cidofovir results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat cisplatin decreases expression ISO PPIG (Homo sapiens) 6480464 Cisplatin results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat clodronic acid decreases expression ISO PPIG (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat coumarin affects phosphorylation ISO PPIG (Homo sapiens) 6480464 coumarin affects the phosphorylation of PPIG protein CTD PMID:35688186 Ppig Rat cyclosporin A increases expression ISO PPIG (Homo sapiens) 6480464 Cyclosporine results in increased expression of PPIG mRNA CTD PMID:25562108 Ppig Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of PPIG protein CTD PMID:34896426 Ppig Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of PPIG protein CTD PMID:34896426 Ppig Rat diarsenic trioxide increases expression ISO PPIG (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPIG mRNA CTD PMID:20458559 Ppig Rat Dibutyl phosphate affects expression ISO PPIG (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PPIG mRNA CTD PMID:37042841 Ppig Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of PPIG mRNA CTD PMID:30934153 Ppig Rat dicrotophos decreases expression ISO PPIG (Homo sapiens) 6480464 dicrotophos results in decreased expression of PPIG mRNA CTD PMID:28302478 Ppig Rat dioxygen affects expression ISO PPIG (Homo sapiens) 6480464 Oxygen deficiency affects the expression of PPIG mRNA CTD PMID:25596134 Ppig Rat dorsomorphin multiple interactions ISO PPIG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPIG mRNA CTD PMID:27188386 Ppig Rat doxorubicin increases expression ISO PPIG (Homo sapiens) 6480464 Doxorubicin results in increased expression of PPIG mRNA CTD PMID:29803840 Ppig Rat elemental selenium decreases expression ISO PPIG (Homo sapiens) 6480464 Selenium results in decreased expression of PPIG mRNA CTD PMID:19244175 Ppig Rat enzyme inhibitor multiple interactions ISO PPIG (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PPIG protein CTD PMID:23301498 Ppig Rat ethanol affects splicing ISO Ppig (Mus musculus) 6480464 Ethanol affects the splicing of PPIG mRNA CTD PMID:30319688 Ppig Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PPIG mRNA CTD PMID:30307764 Ppig Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of PPIG protein CTD PMID:34896426 Ppig Rat folic acid multiple interactions ISO Ppig (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PPIG mRNA CTD PMID:22206623 Ppig Rat formaldehyde decreases expression ISO PPIG (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PPIG mRNA CTD PMID:23649840 Ppig Rat FR900359 increases phosphorylation ISO PPIG (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PPIG protein CTD PMID:37730182 Ppig Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PPIG protein CTD PMID:24552547 Ppig Rat ifosfamide decreases expression ISO PPIG (Homo sapiens) 6480464 Ifosfamide results in decreased expression of PPIG mRNA CTD PMID:25596134 Ppig Rat ivermectin decreases expression ISO PPIG (Homo sapiens) 6480464 Ivermectin results in decreased expression of PPIG protein CTD PMID:32959892 Ppig Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PPIG mRNA CTD PMID:38685447 Ppig Rat N(6)-dimethylallyladenine increases expression ISO PPIG (Homo sapiens) 6480464 N(6)-(delta(2)-isopentenyl)adenine results in increased expression of PPIG mRNA CTD PMID:16129123 Ppig Rat paracetamol decreases expression ISO PPIG (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PPIG mRNA CTD PMID:29067470 Ppig Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PPIG mRNA CTD PMID:33387578 Ppig Rat perfluorooctane-1-sulfonic acid decreases expression ISO PPIG (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PPIG mRNA CTD PMID:27153767 Ppig Rat phenobarbital decreases expression ISO Ppig (Mus musculus) 6480464 Phenobarbital results in decreased expression of PPIG mRNA CTD PMID:23091169 Ppig Rat phenylmercury acetate decreases expression ISO PPIG (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PPIG mRNA CTD PMID:26272509 Ppig Rat phenylmercury acetate multiple interactions ISO PPIG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPIG mRNA CTD PMID:27188386 Ppig Rat pyrethrins affects expression EXP 6480464 Pyrethrins affects the expression of PPIG protein CTD PMID:34896426 Ppig Rat SB 431542 multiple interactions ISO PPIG (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPIG mRNA CTD PMID:27188386 Ppig Rat selenium atom decreases expression ISO PPIG (Homo sapiens) 6480464 Selenium results in decreased expression of PPIG mRNA CTD PMID:19244175 Ppig Rat Soman increases expression EXP 6480464 Soman results in increased expression of PPIG mRNA CTD PMID:19281266 Ppig Rat sunitinib increases expression ISO PPIG (Homo sapiens) 6480464 Sunitinib results in increased expression of PPIG mRNA CTD PMID:31533062 Ppig Rat testosterone enanthate affects expression ISO PPIG (Homo sapiens) 6480464 testosterone enanthate affects the expression of PPIG mRNA CTD PMID:17440010 Ppig Rat tetraphene multiple interactions ISO Ppig (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PPIG mRNA CTD PMID:27858113 Ppig Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PPIG mRNA CTD PMID:33387578 Ppig Rat triptonide increases expression ISO Ppig (Mus musculus) 6480464 triptonide results in increased expression of PPIG mRNA CTD PMID:33045310 Ppig Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PPIG mRNA CTD PMID:21318169 Ppig Rat valproic acid decreases expression ISO PPIG (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPIG mRNA CTD PMID:23179753 more ... Ppig Rat vitamin E decreases expression ISO PPIG (Homo sapiens) 6480464 Vitamin E results in decreased expression of PPIG mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) acetylsalicylic acid (ISO) allethrin (EXP) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenous acid (ISO) asbestos (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chloroacetaldehyde (ISO) chloroprene (EXP) chlorpyrifos (ISO) chrysene (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) coumarin (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) genistein (EXP) ifosfamide (ISO) ivermectin (ISO) methimazole (EXP) N(6)-dimethylallyladenine (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pyrethrins (EXP) SB 431542 (ISO) selenium atom (ISO) Soman (EXP) sunitinib (ISO) testosterone enanthate (ISO) tetraphene (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (EXP,ISO) vitamin E (ISO)
Ppig Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 74,891,846 - 74,923,010 (+) NCBI GRCr8 mRatBN7.2 3 54,484,023 - 54,512,929 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 54,484,023 - 54,512,926 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 57,884,329 - 57,913,330 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 66,467,923 - 66,496,924 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 64,230,295 - 64,259,295 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 55,960,067 - 55,988,968 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 51,866,989 - 51,895,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 51,763,360 - 51,792,262 (+) NCBI Celera 3 54,044,534 - 54,073,434 (+) NCBI Celera Cytogenetic Map 3 q21 NCBI
PPIG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 169,584,351 - 169,641,406 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 169,584,342 - 169,641,406 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 170,440,861 - 170,497,916 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 170,149,096 - 170,202,500 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 170,266,356 - 170,319,760 NCBI Celera 2 164,059,707 - 164,113,097 (+) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 162,331,355 - 162,384,738 (+) NCBI HuRef CHM1_1 2 170,447,258 - 170,500,644 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 170,060,945 - 170,118,571 (+) NCBI T2T-CHM13v2.0
Ppig Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 69,553,152 - 69,584,356 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 69,552,889 - 69,584,356 (+) Ensembl GRCm39 Ensembl GRCm38 2 69,722,753 - 69,754,059 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 69,722,545 - 69,754,012 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 69,561,145 - 69,592,116 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 69,514,062 - 69,554,898 (+) NCBI MGSCv36 mm8 Celera 2 71,392,470 - 71,423,440 (+) NCBI Celera Cytogenetic Map 2 C2 NCBI cM Map 2 40.95 NCBI
Ppig Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 4,915,753 - 4,958,220 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 4,915,747 - 4,958,456 (-) NCBI ChiLan1.0 ChiLan1.0
PPIG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 72,242,553 - 72,296,012 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 72,257,531 - 72,310,985 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 56,854,219 - 56,911,325 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 174,322,609 - 174,379,281 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 174,322,828 - 174,379,281 (+) Ensembl panpan1.1 panPan2
PPIG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 14,306,458 - 14,357,757 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 14,307,160 - 14,353,412 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 14,316,783 - 14,363,731 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 14,423,108 - 14,470,046 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 14,423,798 - 14,469,822 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 14,506,556 - 14,553,473 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 14,497,070 - 14,544,595 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 14,608,716 - 14,655,769 (+) NCBI UU_Cfam_GSD_1.0
Ppig
PPIG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 75,940,865 - 75,979,164 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 75,940,397 - 75,979,168 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 85,061,430 - 85,095,641 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPIG
Ppig
.
Predicted Target Of
Count of predictions: 207 Count of miRNA genes: 131 Interacting mature miRNAs: 163 Transcripts: ENSRNOT00000010216 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1582249 Bw77 Body weight QTL 77 3.2 0.0025 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 64655484 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
RH144287
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 20 464.8 UniSTS Cytogenetic Map 3 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010216 ⟹ ENSRNOP00000010216
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 54,484,023 - 54,512,926 (+) Ensembl Rnor_6.0 Ensembl 3 55,960,067 - 55,988,968 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086584 ⟹ ENSRNOP00000073367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 55,960,327 - 55,987,872 (+) Ensembl
RefSeq Acc Id:
NM_031793 ⟹ NP_113981
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,846 - 74,920,750 (+) NCBI mRatBN7.2 3 54,484,023 - 54,512,929 (+) NCBI Rnor_6.0 3 55,960,067 - 55,988,971 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI RGSC_v3.4 3 51,866,989 - 51,895,893 (+) RGD Celera 3 54,044,534 - 54,073,434 (+) RGD
Sequence:
TGACGTACTTCCGGGGCGACATTTTCCCTCCACGCCTGGACTGGGCTGTGGGGGAGGGAGGCGGTTAGTGGGCTTTAGCGCCTTTCCCGACGGCGGTAGATTTGAAGCGCTTCGGAGGACCGGAGAAG
hide sequence
RefSeq Acc Id:
XM_006234324 ⟹ XP_006234386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,914 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,091 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGAAGGTGAATATTAGACGTTCCTTGGAGGCAGAACGTCTAAACACAGAGCATGTCAATGTTTATAA
hide sequence
RefSeq Acc Id:
XM_006234325 ⟹ XP_006234387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,892,264 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,443 - 54,511,837 (+) NCBI Rnor_6.0 3 55,960,280 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
GAGCGGGAAGGGCCCAGGGCGAGGGGCGGAGCCGAAGCGGGTGGCTGGGCCGAGGTAACCGTCTTTCCGACGAGGTCTCTGAGCTATTCGCGCTCGGAAGGGTGGCCCCGGGGACCGCGGAGCGGCCT
hide sequence
RefSeq Acc Id:
XM_006234326 ⟹ XP_006234388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,913 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,093 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGAAGGTGAATATTAGACGTTCCTTGGAGGCAGAACGTCTAAACACAGAGCATGTCAATGTTTATAA
hide sequence
RefSeq Acc Id:
XM_006234327 ⟹ XP_006234389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,914 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,065 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGA
hide sequence
RefSeq Acc Id:
XM_006234328 ⟹ XP_006234390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,862 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,039 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGAAGGTGAATATTAGACGTTCCTTGGAGGCAGAACGTCTAAACACAGAGCATGTCAATGTTTATAA
hide sequence
RefSeq Acc Id:
XM_006234330 ⟹ XP_006234392
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,892,264 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,283 - 54,511,837 (+) NCBI Rnor_6.0 3 55,960,280 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
GAGCGGGAAGGGCCCAGGGCGAGGGGCGGAGCCGAAGCGGGTGGCTGGGCCGAGGTAACCGTCT
hide sequence
RefSeq Acc Id:
XM_006234331 ⟹ XP_006234393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,863 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,038 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGA
hide sequence
RefSeq Acc Id:
XM_006234333 ⟹ XP_006234395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,914 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,091 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGA
hide sequence
RefSeq Acc Id:
XM_006234334 ⟹ XP_006234396
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,892,264 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,443 - 54,511,837 (+) NCBI Rnor_6.0 3 55,960,280 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
GAGCGGGAAGGGCCCAGGGCGAGGGGCGGAGCCGAAGCGGGTGGCTGGGCCGAGGTAACCGTCT
hide sequence
RefSeq Acc Id:
XM_006234335 ⟹ XP_006234397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,861 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,038 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI Rnor_5.0 3 62,571,744 - 62,600,516 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGAAGGTGAATATTAGACGTTCCTTGGAGGCAGAACGTCTAAACACAGAGCATGTCAATGTTTATAA
hide sequence
RefSeq Acc Id:
XM_017592063 ⟹ XP_017447552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,914 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,091 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGA
hide sequence
RefSeq Acc Id:
XM_017592064 ⟹ XP_017447553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,878 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,039 - 54,511,837 (+) NCBI Rnor_6.0 3 55,959,756 - 55,990,040 (+) NCBI
Sequence:
AGGCATGCGCTACCACACCCCAAAAGTAGCTCATCTTTGTTACTAGTTTTTGAGCGTTTGCCGA
hide sequence
RefSeq Acc Id:
XM_039105945 ⟹ XP_038961873
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,892,263 - 74,923,010 (+) NCBI mRatBN7.2 3 54,484,443 - 54,511,837 (+) NCBI
RefSeq Acc Id:
XM_063284657 ⟹ XP_063140727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,892,264 - 74,923,010 (+) NCBI
RefSeq Acc Id:
XM_063284658 ⟹ XP_063140728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,891,862 - 74,923,010 (+) NCBI
RefSeq Acc Id:
XM_063284660 ⟹ XP_063140730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 74,901,106 - 74,923,010 (+) NCBI
RefSeq Acc Id:
NP_113981 ⟸ NM_031793
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), G3V6Y9 (UniProtKB/TrEMBL), A6HM13 (UniProtKB/TrEMBL)
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234386 ⟸ XM_006234324
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234388 ⟸ XM_006234326
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234389 ⟸ XM_006234327
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234395 ⟸ XM_006234333
- Peptide Label:
isoform X1
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), G3V6Y9 (UniProtKB/TrEMBL), A6HM13 (UniProtKB/TrEMBL)
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234390 ⟸ XM_006234328
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234393 ⟸ XM_006234331
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234397 ⟸ XM_006234335
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234387 ⟸ XM_006234325
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234392 ⟸ XM_006234330
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_006234396 ⟸ XM_006234334
- Peptide Label:
isoform X1
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_017447552 ⟸ XM_017592063
- Peptide Label:
isoform X1
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), G3V6Y9 (UniProtKB/TrEMBL), A6HM13 (UniProtKB/TrEMBL)
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
RefSeq Acc Id:
XP_017447553 ⟸ XM_017592064
- Peptide Label:
isoform X1
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), G3V6Y9 (UniProtKB/TrEMBL), A6HM13 (UniProtKB/TrEMBL)
- Sequence:
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITT
hide sequence
Ensembl Acc Id:
ENSRNOP00000010216 ⟸ ENSRNOT00000010216
Ensembl Acc Id:
ENSRNOP00000073367 ⟸ ENSRNOT00000086584
RefSeq Acc Id:
XP_038961873 ⟸ XM_039105945
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063140728 ⟸ XM_063284658
- Peptide Label:
isoform X1
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), A6HM13 (UniProtKB/TrEMBL), G3V6Y9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140727 ⟸ XM_063284657
- Peptide Label:
isoform X1
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot), A6HM13 (UniProtKB/TrEMBL), G3V6Y9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140730 ⟸ XM_063284660
- Peptide Label:
isoform X2
- UniProtKB:
Q5U346 (UniProtKB/Swiss-Prot), O55035 (UniProtKB/Swiss-Prot)
RGD ID: 13692118 Promoter ID: EPDNEW_R2643 Type: initiation region Name: Ppig_2 Description: peptidylprolyl isomerase G SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R2645 EPDNEW_R2644 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 55,960,133 - 55,960,193 EPDNEW
RGD ID: 13692129 Promoter ID: EPDNEW_R2644 Type: initiation region Name: Ppig_3 Description: peptidylprolyl isomerase G SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R2643 EPDNEW_R2645 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 55,960,313 - 55,960,373 EPDNEW
RGD ID: 13692122 Promoter ID: EPDNEW_R2645 Type: multiple initiation site Name: Ppig_1 Description: peptidylprolyl isomerase G SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R2643 EPDNEW_R2644 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 55,960,526 - 55,960,586 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Ppig
peptidylprolyl isomerase G
matrin cyclophilin (matrin-cyp)
Name updated
1299863 APPROVED
2002-08-07
Ppig
matrin cyclophilin (matrin-cyp)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localizes in the nucleus, and nuclear matrix
633708
gene_process
may fucntion as molecular chaperone involved in the dynamic regulation of the nuclear speckle domains
633708
gene_process
may mediate nuclear architecture for coupling transcription and RNA splicing in the cell nucleus
633708
gene_protein
752 amino acids; 88 kDa
633708
