Advanced Search (OLGA)

Gene: Atp5pb (ATP synthase peripheral stalk-membrane subunit b) Rattus norvegicus

Analyze

Symbol:

Atp5pb

Name:

ATP synthase peripheral stalk-membrane subunit b

RGD ID:

620041

Description:

Contributes to ATP hydrolysis activity. Involved in cellular response to hypoxia. Part of proton-transporting ATP synthase complex. Orthologous to human ATP5PB (ATP synthase peripheral stalk-membrane subunit b); PARTICIPATES IN electron transport chain pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATP synthase F(0) complex subunit B1, mitochondrial; ATP synthase peripheral stalk subunit b, mitochondrial; ATP synthase subunit b; ATP synthase subunit b, mitochondrial; ATP synthase subunit b, mitochondrial-like; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; Atp5f1; ATPase subunit b; LOC100911417

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5PB (ATP synthase peripheral stalk-membrane subunit b)	RGD	RGD
Mus musculus (house mouse):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5PB (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC100688796 (ATP synthase F(0) complex subunit B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5PB (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5PB (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Atp5pb (ATP synthase peripheral stalk-membrane subunit b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATP5PB (ATP synthase peripheral stalk-membrane subunit b)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5pb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATP4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ATPsynB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	asb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asb-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	asb-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atp5pb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,112,459 - 196,123,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	196,112,108 - 196,124,387 (-)	Ensembl				GRCr8
mRatBN7.2	2	193,424,138 - 193,435,418 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,424,047 - 193,435,418 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	201,018,609 - 201,029,888 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,914,310 - 198,925,477 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,731,277 - 193,742,444 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,566,385 - 208,577,147 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,566,385 - 208,577,146 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,408,890 - 208,420,163 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	227,987,601 - 227,998,363 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	201,195,390 - 201,206,585 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	186,126,257 - 186,137,862 (-)	NCBI		Celera
RGSC_v3.1	2	201,158,143 - 201,169,339 (-)	NCBI
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

clear cell renal cell carcinoma (ISO)

COVID-19 (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Bufotalin (ISO)

calcitriol (ISO)

chloropicrin (ISO)

clotrimazole (EXP)

clozapine (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

disodium selenite (ISO)

diuron (ISO)

doxorubicin (ISO)

enniatin (ISO)

ethanol (EXP,ISO)

eugenol (EXP)

fenthion (ISO)

folic acid (ISO)

furfural (ISO)

hydrogen peroxide (ISO)

isoniazide (ISO)

ivermectin (ISO)

josamycin (ISO)

lipopolysaccharide (ISO)

Mesaconitine (EXP)

methimazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

nickel subsulfide (EXP)

niclosamide (ISO)

nitrofen (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

PhIP (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

thiram (ISO)

triptonide (ISO)

valproic acid (ISO)

zearalenone (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hypoxia (IEP)

monoatomic ion transport (IEA)

proton motive force-driven ATP synthesis (IBA,IEA)

proton motive force-driven mitochondrial ATP synthesis (IEA,ISO)

proton transmembrane transport (IEA)

substantia nigra development (ISO)

Cellular Component

mitochondrial inner membrane (IEA)

mitochondrion (IEA,ISO)

proton-transporting ATP synthase complex (IDA,IEA,ISO)

Molecular Function

ATP hydrolysis activity (IDA)

protein binding (ISO)

protein-containing complex binding (IDA)

proton transmembrane transporter activity (IEA)

proton-transporting ATP synthase activity, rotational mechanism (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

electron transport chain pathway (ISO)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Systematic Analysis of the Expression of the Mitochondrial ATP Synthase (Complex V) Subunits in Clear Cell Renal Cell Carcinoma.	Brüggemann M, etal., Transl Oncol. 2017 Aug;10(4):661-668. doi: 10.1016/j.tranon.2017.06.002. Epub 2017 Jun 30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
6.	Distinct expression patterns in hepatitis B virus- and hepatitis C virus-infected hepatocellular carcinoma.	Lee CF, etal., World J Gastroenterol. 2008 Oct 21;14(39):6072-7. doi: 10.3748/wjg.14.6072.
7.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	cDNA cloning and sequencing for the import precursor of subunit B in H(+)-ATP synthase from rat mitochondria.	Tsurumi C, etal., Biochem Biophys Res Commun 1990 May 31;169(1):136-42.
16.	iTRAQ-Based Proteomic Analysis Reveals Recovery of Impaired Mitochondrial Function in Ischemic Myocardium by Shenmai Formula.	Wang Y, etal., J Proteome Res. 2018 Feb 2;17(2):794-803. doi: 10.1021/acs.jproteome.7b00450. Epub 2018 Jan 23.

Additional References at PubMed

PMID:8889548	PMID:12110673	PMID:12865426	PMID:14651853	PMID:15489334	PMID:17634366	PMID:18614015	PMID:19946888	PMID:20833797	PMID:21630459	PMID:22926577	PMID:23376485
PMID:24625528	PMID:29476059	PMID:32357304

Genomics

Comparative Map Data

Atp5pb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,112,459 - 196,123,737 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	196,112,108 - 196,124,387 (-)	Ensembl				GRCr8
mRatBN7.2	2	193,424,138 - 193,435,418 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,424,047 - 193,435,418 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	201,018,609 - 201,029,888 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,914,310 - 198,925,477 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,731,277 - 193,742,444 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,566,385 - 208,577,147 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,566,385 - 208,577,146 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,408,890 - 208,420,163 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	227,987,601 - 227,998,363 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	201,195,390 - 201,206,585 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	186,126,257 - 186,137,862 (-)	NCBI		Celera
RGSC_v3.1	2	201,158,143 - 201,169,339 (-)	NCBI
Cytogenetic Map	2	q34	NCBI

ATP5PB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	111,449,464 - 111,462,773 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	111,448,111 - 111,465,941 (+)	Ensembl			hg38	GRCh38
GRCh37	1	111,992,086 - 112,005,395 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	111,793,266 - 111,806,063 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	111,703,807 - 111,716,113	NCBI
Celera	1	110,238,666 - 110,251,462 (+)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	109,863,192 - 109,875,988 (+)	NCBI		HuRef
CHM1_1	1	112,106,752 - 112,119,548 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	111,464,148 - 111,477,456 (+)	NCBI		T2T-CHM13v2.0

Atp5pb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	105,850,014 - 105,866,579 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	105,850,014 - 105,867,415 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	105,942,698 - 105,959,263 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	105,942,698 - 105,960,099 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	105,745,781 - 105,763,166 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	106,070,919 - 106,088,304 (-)	NCBI		MGSCv36	mm8
Celera	3	108,133,284 - 108,150,668 (-)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	46.46	NCBI

Atp5pb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	14,940,434 - 14,954,310 (+)	Ensembl
ChiLan1.0	NW_004955435	14,940,502 - 14,952,423 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP5PB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	115,561,891 - 115,578,385 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	114,715,332 - 114,727,197 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	114,110,749 - 114,122,715 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	126,224,308 - 126,236,596 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	126,224,725 - 126,235,897 (-)	Ensembl			panPan2	panpan1.1

LOC100688796
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	63,940,486 - 63,954,982 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	40,613,415 - 40,625,979 (-)	Ensembl			canFam3	CanFam3.1
CanFam3.1 Ensembl	6	40,613,415 - 40,625,979 (-)	NCBI			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	63,454,097 - 63,461,699 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha

Atp5pb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	17,342,222 - 17,357,091 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936690	120,561 - 136,795 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936690	120,572 - 135,509 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5PB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	108,896,057 - 108,907,805 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	108,896,063 - 108,907,626 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	119,078,642 - 119,090,149 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5PB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	22,150,488 - 22,162,740 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	22,150,239 - 22,162,312 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	36,316,725 - 36,328,667 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5pb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	7,167,147 - 7,179,273 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624772	7,167,074 - 7,178,756 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atp5pb
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	52,170,426 - 52,181,796 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Atp5pb
137 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Markers in Region

AW531304

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,424,258 - 193,424,459 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,566,506 - 208,566,706	NCBI	Rnor6.0
Rnor_6.0	2	208,409,011 - 208,409,211	NCBI	Rnor6.0
Rnor_5.0	2	227,987,722 - 227,987,922	UniSTS	Rnor5.0
Rnor_5.0	2	227,830,501 - 227,830,701	UniSTS	Rnor5.0
RGSC_v3.4	2	201,195,509 - 201,195,709	UniSTS	RGSC3.4
Celera	2	186,126,378 - 186,126,578	UniSTS
RH 3.4 Map	2	1372.0	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	6	55	130	28	30	17	84	17	253	154	11	125	67	72	13	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC063808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK845764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M35052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021920 ⟹ ENSRNOP00000021920

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,112,461 - 196,123,736 (-)	Ensembl
mRatBN7.2 Ensembl	2	193,424,047 - 193,435,349 (-)	Ensembl
Rnor_6.0 Ensembl	2	208,408,890 - 208,420,163 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075083 ⟹ ENSRNOP00000065147

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,112,461 - 196,120,139 (-)	Ensembl
mRatBN7.2 Ensembl	2	193,424,047 - 193,431,820 (-)	Ensembl
Rnor_6.0 Ensembl	2	208,566,385 - 208,577,146 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	208,576,214 - 208,577,053 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075982 ⟹ ENSRNOP00000068400

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,112,461 - 196,123,640 (-)	Ensembl
mRatBN7.2 Ensembl	2	193,424,056 - 193,435,321 (-)	Ensembl
Rnor_6.0 Ensembl	2	208,569,469 - 208,576,705 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076379

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	208,573,290 - 208,577,043 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076556 ⟹ ENSRNOP00000067965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,112,108 - 196,123,737 (-)	Ensembl
mRatBN7.2 Ensembl	2	193,424,676 - 193,435,418 (-)	Ensembl
Rnor_6.0 Ensembl	2	208,411,969 - 208,419,722 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	208,415,791 - 208,420,060 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	208,419,231 - 208,420,070 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000126288 ⟹ ENSRNOP00000110796

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	196,112,461 - 196,124,387 (-)	Ensembl

RefSeq Acc Id:

NM_134365 ⟹ NP_599192

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,112,459 - 196,123,737 (-)	NCBI
mRatBN7.2	2	193,424,138 - 193,435,418 (-)	NCBI
Rnor_6.0	2	208,566,385 - 208,577,147 (-)	NCBI
Rnor_5.0	2	227,987,601 - 227,998,363 (-)	NCBI
RGSC_v3.4	2	201,195,390 - 201,206,585 (-)	RGD
Celera	2	186,126,257 - 186,137,862 (-)	NCBI

Sequence:

show sequence

GAAAAAAATCAGCACTTCCGAGAGAAAGTGTGCAGATCTCTTCTCGCGAGATATGTGAGCGGCC
ATCTTGTTCCTGCCCCTGAGTGTCTCGGGTCGGGGTCACAGGGACATCGGTACCGCTGTCTGGA
TCTTCGCAGACAATGCTGTCCCGGGTGGTACTTTCTGCCGCCGCCACAGCGGCCCCGTGTCTGA
AGAACGCGGCCGTCCTGGGTCCAGGGGTTTTACAGGCAACAAGGGTCTTTCACACAGGACAGCC
TCGCCTTGCCCCTCTACCACCTCTTCCTGAATATGGAGGAAAAGTACGTCTTGGGCTGATTCCT
GAGGAATTTTTCCAGTTCCTTTACCCTAAGACTGGTGTAACAGGACCCTACGTGCTTGGAACTG
GGCTTAGCTTGTACTTTCTATCCAAAGAAATATATGTGATTACCCCAGAGACCTTCTCTACCAT
ATCAGTAGTAGGGTTGATTGTCTATGTGATTAAGAAATATGGCGCCTCTATTGGAGAATTTATT
GACAAACTTAATGAGGAAAAAATTGCTCAACTAGAAGAAATAAAGCAGTCAAGCATGAAGCAAA
TCCAGGATGCAATCAACAGGGAGAAGGCACAGCAGGCACTGGTTCAGAAGCGCCACTACCTCTT
CGATGTTCAGAGGAATAACATTGCCCTGGCCTTGGAGGTCACTTACCGGGAACGACTACATAAA
GCATATAAGGAGGTAAAGAATCGCCTGGACTACCATATTTCTGTACAGGACATGATGCGTCGCA
AGGAGGGAGAGCACATGATAAACTGGGTGGAGAAGCATGTGATACAGAGCATTTCTGCACAGCA
GGAAAAGGAGACCATTGCCAAGTGCATCGGAGATCTAAAGATGCTTGCAAAGAAGGCTCAAGCT
CAGCCAATTATGTGAATGTGTCTATCTCAGTTGTGATAGCCAGAGAGGGTTAACTTAAATGAGA
ACTACTCTACTTGAAGAACTCTTTCTGTATTGCTGTCTAATGAAATTGTGGTGTACCTTTCCTA
AGAAATGATCAAGGTCCATTTAGTGGCTTAACCCTATTTCTGATCCTTGCTCTGTATTCGGAGT
TGTCTGATCACATTTGAGTAAGCAATTTGCAGCAACTCGCTGCCCAACAGAAATTACCAAGTTA
TAGTTTAAACTTGTAATTAGTTAAAACATCTTACAATAAAATGTTTGAAACAGAAAAAAAAAAA
AAAAA

hide sequence

RefSeq Acc Id:

XM_039101623 ⟹ XP_038957551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,112,459 - 196,123,290 (-)	NCBI
mRatBN7.2	2	193,424,138 - 193,435,337 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_599192	(Get FASTA)	NCBI Sequence Viewer
	XP_038957551	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42187	(Get FASTA)	NCBI Sequence Viewer
	AAH63808	(Get FASTA)	NCBI Sequence Viewer
	EDL81827	(Get FASTA)	NCBI Sequence Viewer
	EDL81828	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021920
	ENSRNOP00000021920.4
	ENSRNOP00000065147
GenBank Protein	P19511	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_599192 ⟸ NM_134365
- Peptide Label:	precursor
- UniProtKB:	P19511 (UniProtKB/Swiss-Prot), A6HUP1 (UniProtKB/TrEMBL), A0A8L2QWG8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLSRVVLSAAATAAPCLKNAAVLGPGVLQATRVFHTGQPRLAPLPPLPEYGGKVRLGLIPEEFF QFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASIGEFIDKLN EEKIAQLEEIKQSSMKQIQDAINREKAQQALVQKRHYLFDVQRNNIALALEVTYRERLHKAYKE VKNRLDYHISVQDMMRRKEGEHMINWVEKHVIQSISAQQEKETIAKCIGDLKMLAKKAQAQPIM hide sequence

Ensembl Acc Id:

ENSRNOP00000068400 ⟸ ENSRNOT00000075982

Ensembl Acc Id:

ENSRNOP00000065147 ⟸ ENSRNOT00000075083

RefSeq Acc Id:	XP_038957551 ⟸ XM_039101623
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QWG8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000067965 ⟸ ENSRNOT00000076556

Ensembl Acc Id:

ENSRNOP00000021920 ⟸ ENSRNOT00000021920

Ensembl Acc Id:

ENSRNOP00000110796 ⟸ ENSRNOT00000126288

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P19511-F1-model_v2	AlphaFold	P19511	1-256	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691649

Promoter ID:

EPDNEW_R2172

Type:

initiation region

Name:

LOC100911417_1

Description:

ATP synthase subunit b, mitochondrial-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	208,577,078 - 208,577,138	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620041	AgrOrtholog
BioCyc Gene	G2FUF-51717	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000016000	Ensembl
	ENSRNOG00000046299	Ensembl
	ENSRNOG00000064742	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021920	ENTREZGENE
	ENSRNOT00000021920.7	UniProtKB/Swiss-Prot
	ENSRNOT00000075083	ENTREZGENE
Gene3D-CATH	1.20.5.2210	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6920021	IMAGE-MGC_LOAD
InterPro	ATP_synth_Bsub_B/MI25	UniProtKB/Swiss-Prot
	ATP_synth_F0_suB	UniProtKB/Swiss-Prot
KEGG Report	rno:171375	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72698	IMAGE-MGC_LOAD
NCBI Gene	171375	ENTREZGENE
PANTHER	ATP SYNTHASE F(0) COMPLEX SUBUNIT B1, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR12733	UniProtKB/Swiss-Prot
Pfam	Mt_ATP-synt_B	UniProtKB/Swiss-Prot
PhenoGen	Atp5pb	PhenoGen
RatGTEx	ENSRNOG00000016000	RatGTEx
	ENSRNOG00000046299	RatGTEx
	ENSRNOG00000064742	RatGTEx
Superfamily-SCOP	ATP synthase B chain-like	UniProtKB/Swiss-Prot
UniProt	A0A096MJ25_RAT	UniProtKB/TrEMBL
	A0A096MK68_RAT	UniProtKB/TrEMBL
	A0A8L2QWG8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LIR4_RAT	UniProtKB/TrEMBL
	A6HUP1	ENTREZGENE, UniProtKB/TrEMBL
	AT5F1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Atp5pb	ATP synthase peripheral stalk-membrane subunit b	LOC100911417	ATP synthase subunit b, mitochondrial-like	Data merged from RGD:6493308	737654	PROVISIONAL
2017-11-30	Atp5pb	ATP synthase peripheral stalk-membrane subunit b	Atp5f1	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911417	ATP synthase subunit b, mitochondrial-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2011-12-01	Atp5f1	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1	Atp5f1	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-06-27	Atp5f1	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1	Atp5f1	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Atp5f1	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Atp5f1	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	contains a mitochondrial import signal	631941

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways