Symbol:
Fut4
Name:
fucosyltransferase 4
RGD ID:
619954
Description:
Enables alpha-(1->3)-fucosyltransferase activity. Predicted to be involved in several processes, including Lewis x epitope biosynthetic process; protein glycosylation; and regulation of leukocyte migration. Predicted to be located in cell periphery; cell surface; and trans-Golgi network. Orthologous to human FUT4 (fucosyltransferase 4); PARTICIPATES IN lacto-series glycosphingolipid metabolic pathway; O-linked glycan biosynthetic pathway; INTERACTS WITH (S)-amphetamine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase; alpha 1,3-fucosyltransferase Fuc-T (similar to mouse Fut4); alpha 13-fucosyltransferase Fuc-T (similar to mouse Fut4); alpha-(1,3)-fucosyltransferase; alpha-(1,3)-fucosyltransferase 4; fuc-TIV; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); fucosyltransferase IV; Fuct; fucT-IV; galactoside 3-L-fucosyltransferase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FUT4 (fucosyltransferase 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Fut4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fut4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FUT4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FUT4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fut4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FUT4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FUT4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fut4 (fucosyltransferase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PCGF6 (polycomb group ring finger 6) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Fut4 (fucosyltransferase 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FUT4 (fucosyltransferase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fut-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
FucTC
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
FucTA
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
fut-6
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fut4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Fut4-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 19,868,178 - 19,872,139 (-) NCBI GRCr8 mRatBN7.2 8 11,586,721 - 11,590,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 11,586,721 - 11,590,682 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 15,571,456 - 15,575,419 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 13,869,199 - 13,873,162 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 11,844,759 - 11,848,737 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 13,258,768 - 13,262,729 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 13,258,768 - 13,262,729 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 13,199,560 - 13,203,521 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 11,541,524 - 11,545,485 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 11,541,524 - 11,545,485 (-) NCBI Celera 8 13,056,457 - 13,060,418 (-) NCBI Celera Cytogenetic Map 8 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fut4 Rat (20S)-ginsenoside Rg3 multiple interactions ISO FUT4 (Homo sapiens) 6480464 ginsenoside Rg3 inhibits the reaction [cagA protein and Helicobacter pylori results in increased expression of FUT4 protein] CTD PMID:26427350 Fut4 Rat (20S)-ginsenoside Rg3 decreases expression ISO FUT4 (Homo sapiens) 6480464 ginsenoside Rg3 results in decreased expression of FUT4 protein CTD PMID:26427350 Fut4 Rat (S)-amphetamine increases expression EXP 6480464 Dextroamphetamine results in increased expression of FUT4 mRNA CTD PMID:16715494 Fut4 Rat 1,2-dimethylhydrazine decreases expression ISO Fut4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of FUT4 mRNA CTD PMID:22206623 Fut4 Rat 17beta-estradiol multiple interactions ISO FUT4 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of FUT4 mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of FUT4 mRNA CTD PMID:20404318 and PMID:30165855 Fut4 Rat 17beta-estradiol increases expression ISO FUT4 (Homo sapiens) 6480464 Estradiol results in increased expression of FUT4 mRNA CTD PMID:31614463 Fut4 Rat 17beta-estradiol multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of FUT4 mRNA CTD PMID:32741896 Fut4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO FUT4 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of FUT4 mRNA] CTD PMID:11007951 Fut4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FUT4 mRNA CTD PMID:33387578 Fut4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Fut4 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of FUT4 mRNA CTD PMID:25975270 Fut4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fut4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FUT4 mRNA CTD PMID:21570461 Fut4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO FUT4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of FUT4 mRNA CTD PMID:11007951 Fut4 Rat 2-Ethylhexanoic acid increases expression ISO Fut4 (Mus musculus) 6480464 2-ethylhexanoic acid results in increased expression of FUT4 mRNA CTD PMID:30578912 Fut4 Rat 4,4'-sulfonyldiphenol increases expression ISO Fut4 (Mus musculus) 6480464 bisphenol S results in increased expression of FUT4 mRNA CTD PMID:30951980 Fut4 Rat 4,4'-sulfonyldiphenol affects methylation ISO Fut4 (Mus musculus) 6480464 bisphenol S affects the methylation of FUT4 gene CTD PMID:31683443 Fut4 Rat 4,4'-sulfonyldiphenol increases methylation ISO Fut4 (Mus musculus) 6480464 bisphenol S results in increased methylation of FUT4 exon CTD PMID:33297965 Fut4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of FUT4 mRNA CTD PMID:31881176 Fut4 Rat acrolein decreases expression EXP 6480464 Acrolein results in decreased expression of FUT4 mRNA CTD PMID:38090360 Fut4 Rat aflatoxin B1 decreases methylation ISO FUT4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FUT4 gene CTD PMID:27153756 Fut4 Rat all-trans-retinoic acid decreases expression ISO Fut4 (Mus musculus) 6480464 Tretinoin results in decreased expression of FUT4 protein CTD PMID:19808863 Fut4 Rat all-trans-retinoic acid increases expression ISO FUT4 (Homo sapiens) 6480464 Tretinoin results in increased expression of FUT4 mRNA and Tretinoin results in increased expression of FUT4 protein CTD PMID:15498508 and PMID:33167477 Fut4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FUT4 mRNA CTD PMID:35163327 Fut4 Rat amiodarone decreases expression EXP 6480464 Amiodarone results in decreased expression of FUT4 mRNA CTD PMID:17991464 Fut4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of FUT4 mRNA CTD PMID:16483693 Fut4 Rat arsane affects methylation ISO FUT4 (Homo sapiens) 6480464 Arsenic affects the methylation of FUT4 gene CTD PMID:25304211 Fut4 Rat arsenic atom affects methylation ISO FUT4 (Homo sapiens) 6480464 Arsenic affects the methylation of FUT4 gene CTD PMID:25304211 Fut4 Rat arsenous acid decreases expression ISO Fut4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of FUT4 protein CTD PMID:29767511 Fut4 Rat benzo[a]pyrene increases methylation ISO FUT4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FUT4 5' UTR more ... CTD PMID:27901495 Fut4 Rat bisphenol A decreases expression ISO Fut4 (Mus musculus) 6480464 bisphenol A results in decreased expression of FUT4 mRNA CTD PMID:26063408 Fut4 Rat bisphenol A multiple interactions ISO FUT4 (Homo sapiens) 6480464 endotoxin and Escherichia coli inhibits the reaction [bisphenol A results in decreased expression of FUT4 protein] CTD PMID:32080224 Fut4 Rat bisphenol A decreases expression ISO FUT4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of FUT4 protein CTD PMID:32080224 Fut4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FUT4 mRNA CTD PMID:30816183 Fut4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FUT4 mRNA CTD PMID:25181051 Fut4 Rat calcitriol decreases expression ISO FUT4 (Homo sapiens) 6480464 Calcitriol results in decreased expression of FUT4 mRNA CTD PMID:16002434 Fut4 Rat carbon nanotube increases expression ISO Fut4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Fut4 Rat chlordecone decreases expression ISO Fut4 (Mus musculus) 6480464 Chlordecone results in decreased expression of FUT4 mRNA CTD PMID:33711761 Fut4 Rat chlordecone increases expression ISO Fut4 (Mus musculus) 6480464 Chlordecone results in increased expression of FUT4 mRNA CTD PMID:33711761 Fut4 Rat choline multiple interactions ISO Fut4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FUT4 mRNA CTD PMID:20938992 Fut4 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of FUT4 mRNA CTD PMID:24386269 Fut4 Rat cordycepin increases expression ISO Fut4 (Mus musculus) 6480464 cordycepin results in increased expression of FUT4 protein CTD PMID:32042022 Fut4 Rat cordycepin multiple interactions ISO Fut4 (Mus musculus) 6480464 alpha-cyano-(3 and 4-dihydroxy)-N-benzylcinnamide inhibits the reaction [cordycepin results in increased expression of FUT4 protein] CTD PMID:32042022 Fut4 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FUT4 mRNA CTD PMID:27523638 Fut4 Rat cycloheximide multiple interactions ISO FUT4 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of FUT4 mRNA] CTD PMID:11007951 Fut4 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of FUT4 mRNA CTD PMID:23914054 Fut4 Rat diarsenic trioxide decreases expression ISO Fut4 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of FUT4 protein CTD PMID:29767511 Fut4 Rat Dibutyl phosphate affects expression ISO FUT4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FUT4 mRNA CTD PMID:37042841 Fut4 Rat dorsomorphin multiple interactions ISO FUT4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fut4 Rat doxorubicin decreases expression ISO FUT4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of FUT4 protein CTD PMID:17852453 Fut4 Rat entinostat increases expression ISO FUT4 (Homo sapiens) 6480464 entinostat results in increased expression of FUT4 mRNA CTD PMID:26272509 Fut4 Rat entinostat multiple interactions ISO FUT4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FUT4 mRNA CTD PMID:27188386 Fut4 Rat ethanol increases expression ISO FUT4 (Homo sapiens) 6480464 Ethanol results in increased expression of FUT4 protein CTD PMID:19919524 Fut4 Rat ethanol multiple interactions ISO FUT4 (Homo sapiens) 6480464 HBEGF protein inhibits the reaction [Ethanol results in increased expression of FUT4 protein] CTD PMID:19919524 Fut4 Rat ethyl methanesulfonate decreases expression ISO FUT4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of FUT4 mRNA CTD PMID:23649840 Fut4 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of FUT4 mRNA CTD PMID:31881178 Fut4 Rat folic acid multiple interactions ISO Fut4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FUT4 mRNA CTD PMID:20938992 Fut4 Rat formaldehyde decreases expression ISO FUT4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of FUT4 mRNA CTD PMID:20655997 and PMID:23649840 Fut4 Rat furan increases expression EXP 6480464 furan results in increased expression of FUT4 mRNA CTD PMID:27387713 Fut4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of FUT4 mRNA CTD PMID:33387578 Fut4 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of FUT4 mRNA CTD PMID:24915197 Fut4 Rat L-methionine multiple interactions ISO Fut4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of FUT4 mRNA CTD PMID:20938992 Fut4 Rat lead diacetate multiple interactions ISO FUT4 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of FUT4 mRNA CTD PMID:22839698 Fut4 Rat metformin increases expression ISO FUT4 (Homo sapiens) 6480464 Metformin results in increased expression of FUT4 protein CTD PMID:26036281 Fut4 Rat methyl methanesulfonate decreases expression ISO FUT4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of FUT4 mRNA CTD PMID:23649840 Fut4 Rat nickel atom increases expression ISO FUT4 (Homo sapiens) 6480464 Nickel results in increased expression of FUT4 mRNA CTD PMID:25583101 Fut4 Rat oligomycin A increases expression ISO FUT4 (Homo sapiens) 6480464 oligomycin A results in increased expression of FUT4 protein CTD PMID:26036281 Fut4 Rat ozone multiple interactions ISO Fut4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of FUT4 mRNA CTD PMID:34911549 Fut4 Rat panobinostat multiple interactions ISO FUT4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FUT4 mRNA CTD PMID:27188386 Fut4 Rat panobinostat increases expression ISO FUT4 (Homo sapiens) 6480464 panobinostat results in increased expression of FUT4 mRNA CTD PMID:26272509 Fut4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of FUT4 mRNA CTD PMID:33387578 Fut4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FUT4 mRNA CTD PMID:35163327 Fut4 Rat Phenelzine increases expression ISO Fut4 (Mus musculus) 6480464 Phenelzine results in increased expression of FUT4 mRNA CTD PMID:31249575 Fut4 Rat phorbol 13-acetate 12-myristate increases expression ISO FUT4 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of FUT4 protein CTD PMID:26036281 Fut4 Rat rotenone decreases expression ISO FUT4 (Homo sapiens) 6480464 Rotenone results in decreased expression of FUT4 mRNA CTD PMID:33512557 Fut4 Rat SB 431542 multiple interactions ISO FUT4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fut4 Rat sodium arsenite increases expression ISO FUT4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of FUT4 mRNA CTD PMID:34032870 Fut4 Rat sodium arsenite decreases expression ISO Fut4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of FUT4 mRNA CTD PMID:37682722 Fut4 Rat Soman increases expression EXP 6480464 Soman results in increased expression of FUT4 mRNA CTD PMID:19281266 Fut4 Rat tamibarotene increases expression ISO FUT4 (Homo sapiens) 6480464 tamibarotene results in increased expression of FUT4 mRNA CTD PMID:15498508 Fut4 Rat testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Estradiol] results in increased expression of FUT4 mRNA CTD PMID:32741896 Fut4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of FUT4 mRNA CTD PMID:34492290 Fut4 Rat titanium dioxide decreases methylation ISO Fut4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of FUT4 gene CTD PMID:35295148 Fut4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of FUT4 mRNA CTD PMID:33387578 Fut4 Rat trichostatin A increases expression ISO FUT4 (Homo sapiens) 6480464 trichostatin A results in increased expression of FUT4 mRNA CTD PMID:24935251 Fut4 Rat trovafloxacin increases expression ISO Fut4 (Mus musculus) 6480464 trovafloxacin results in increased expression of FUT4 mRNA CTD PMID:35537566 Fut4 Rat urethane decreases expression ISO FUT4 (Homo sapiens) 6480464 Urethane results in decreased expression of FUT4 mRNA CTD PMID:28818685 Fut4 Rat valproic acid increases methylation ISO FUT4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of FUT4 gene CTD PMID:29154799 Fut4 Rat valproic acid increases expression ISO Fut4 (Mus musculus) 6480464 Valproic Acid results in increased expression of FUT4 mRNA CTD PMID:30578912 Fut4 Rat valproic acid multiple interactions ISO FUT4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FUT4 mRNA CTD PMID:27188386 Fut4 Rat valproic acid increases expression ISO FUT4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FUT4 mRNA CTD PMID:23179753 more ... Fut4 Rat valproic acid affects expression ISO FUT4 (Homo sapiens) 6480464 Valproic Acid affects the expression of FUT4 mRNA CTD PMID:25979313 Fut4 Rat zinc protoporphyrin multiple interactions ISO FUT4 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of FUT4 mRNA CTD PMID:22839698
Imported Annotations - KEGG (archival)
Biological Process
fucosylation (IBA) glycosphingolipid biosynthetic process (ISO,ISS) inflammatory response (IEA) Lewis x epitope biosynthetic process (ISO,ISS) lymphocyte migration into lymph node (IEA,ISO,ISS) oligosaccharide metabolic process (IEA,ISO,ISS) positive regulation of leukocyte tethering or rolling (IEA,ISO,ISS) positive regulation of neutrophil migration (IEA,ISO,ISS) protein glycosylation (IEA) protein N-linked glycosylation (ISO,ISS) protein O-linked glycosylation (ISO,ISS) regulation of leukocyte cell-cell adhesion (ISO,ISS)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Cloning of a rat alpha1,3-fucosyltransferase gene: a member of the fucosyltransferase IV family.
Sajdel-Sulkowska EM, etal., Glycoconj J 1997 Feb;14(2):249-58.
10.
Pax6 controls the expression of Lewis x epitope in the embryonic forebrain by regulating alpha 1,3-fucosyltransferase IX expression.
Shimoda Y, etal., J Biol Chem 2002 Jan 18;277(3):2033-9.
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Fut4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 19,868,178 - 19,872,139 (-) NCBI GRCr8 mRatBN7.2 8 11,586,721 - 11,590,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 11,586,721 - 11,590,682 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 15,571,456 - 15,575,419 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 13,869,199 - 13,873,162 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 11,844,759 - 11,848,737 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 13,258,768 - 13,262,729 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 13,258,768 - 13,262,729 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 13,199,560 - 13,203,521 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 11,541,524 - 11,545,485 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 11,541,524 - 11,545,485 (-) NCBI Celera 8 13,056,457 - 13,060,418 (-) NCBI Celera Cytogenetic Map 8 q12 NCBI
FUT4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 94,543,921 - 94,549,895 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 94,543,921 - 94,549,895 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 94,277,087 - 94,283,061 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 93,916,775 - 93,922,712 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 93,916,774 - 93,922,712 NCBI Celera 11 91,564,827 - 91,570,875 (+) NCBI Celera Cytogenetic Map 11 q21 NCBI HuRef 11 90,342,221 - 90,348,273 (+) NCBI HuRef CHM1_1 11 94,160,008 - 94,166,060 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 94,550,967 - 94,556,942 (+) NCBI T2T-CHM13v2.0
Fut4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 14,659,755 - 14,663,418 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 14,659,616 - 14,663,689 (-) Ensembl GRCm39 Ensembl GRCm38 9 14,748,459 - 14,752,122 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 14,748,320 - 14,752,393 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 14,552,903 - 14,556,566 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 14,498,852 - 14,502,515 (-) NCBI MGSCv36 mm8 Celera 9 12,028,933 - 12,032,596 (-) NCBI Celera Cytogenetic Map 9 A2 NCBI cM Map 9 4.3 NCBI
Fut4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955605 397,721 - 398,470 (-) NCBI ChiLan1.0 ChiLan1.0
FUT4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 95,379,390 - 95,413,344 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 96,470,878 - 96,507,402 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 89,550,637 - 89,566,111 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 93,034,946 - 93,041,893 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 93,036,119 - 93,037,711 (+) Ensembl panpan1.1 panPan2
FUT4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 6,386,665 - 6,390,109 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 6,389,021 - 6,390,793 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 6,397,366 - 6,401,819 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 6,567,061 - 6,570,571 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 21 6,354,240 - 6,358,357 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 6,419,443 - 6,420,749 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 6,466,083 - 6,470,537 (-) NCBI UU_Cfam_GSD_1.0
Fut4
FUT4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 26,679,868 - 26,681,541 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 26,679,540 - 26,686,217 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 30,433,511 - 30,436,409 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FUT4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 85,747,612 - 85,752,557 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 85,748,886 - 85,750,481 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 40,024,888 - 40,028,623 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fut4
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 30 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000012176 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 9590084 Insglur5 Insulin/glucose ratio QTL 5 18.54 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 8 1 24597739 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat
BF412716
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 11,588,101 - 11,588,312 (+) MAPPER mRatBN7.2 Rnor_6.0 8 13,260,149 - 13,260,359 NCBI Rnor6.0 Rnor_5.0 8 13,200,941 - 13,201,151 UniSTS Rnor5.0 RGSC_v3.4 8 11,542,905 - 11,543,115 UniSTS RGSC3.4 Celera 8 13,057,838 - 13,058,048 UniSTS RH 3.4 Map 8 109.2 UniSTS Cytogenetic Map 8 q11 UniSTS
AI237192
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 11,586,833 - 11,587,030 (+) MAPPER mRatBN7.2 Rnor_6.0 8 13,258,881 - 13,259,077 NCBI Rnor6.0 Rnor_5.0 8 13,199,673 - 13,199,869 UniSTS Rnor5.0 RGSC_v3.4 8 11,541,637 - 11,541,833 UniSTS RGSC3.4 Celera 8 13,056,570 - 13,056,766 UniSTS RH 3.4 Map 8 119.2 UniSTS Cytogenetic Map 8 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012176 ⟹ ENSRNOP00000012176
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 11,586,721 - 11,590,682 (-) Ensembl Rnor_6.0 Ensembl 8 13,258,768 - 13,262,729 (-) Ensembl
RefSeq Acc Id:
NM_022219 ⟹ NP_071555
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 19,868,178 - 19,872,139 (-) NCBI mRatBN7.2 8 11,586,721 - 11,590,682 (-) NCBI Rnor_6.0 8 13,258,768 - 13,262,729 (-) NCBI Rnor_5.0 8 13,199,560 - 13,203,521 (-) NCBI RGSC_v3.4 8 11,541,524 - 11,545,485 (-) RGD Celera 8 13,056,457 - 13,060,418 (-) RGD
Sequence:
CGCACCCCTACCCCGCCACCCCTTCGAGGTGCAGGTCTCCAGTGCAAGACTCTCTCTGCAAGGCGAGGACTCAGGTCACCTAGTCGCGGGACCAGCGAACGCATCAAGAGGCCACGACCCCCGGTGAG
hide sequence
RefSeq Acc Id:
NP_071555 ⟸ NM_022219
- UniProtKB:
G3V757 (UniProtKB/TrEMBL), A6JN98 (UniProtKB/TrEMBL), Q99N88 (UniProtKB/TrEMBL)
- Sequence:
MAPAGRKLQHESRCRPSRPVDAWRAAATTRGRCMGTPGARRRARRGGWGLPRTSSGLAAAGLLCTALTACLCWGQLPPLPWASPAPQRPVSVLLWWEPFGGRGGHSKPPPDCSLRFNISGCRLLTDRA
hide sequence
Ensembl Acc Id:
ENSRNOP00000012176 ⟸ ENSRNOT00000012176
RGD ID: 13695747 Promoter ID: EPDNEW_R6270 Type: initiation region Name: Fut4_1 Description: fucosyltransferase 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 13,262,745 - 13,262,805 EPDNEW
BioCyc Gene G2FUF-31687 BioCyc
BioCyc Pathway PWY-7831 [ABH and Lewis epitopes biosynthesis from type 2 precursor disaccharide] BioCyc
BioCyc Pathway Image PWY-7831 BioCyc
Ensembl Genes ENSRNOG00000009157 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000012176.4 UniProtKB/TrEMBL
Gene3D-CATH 3.40.50.11660 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:5621698 IMAGE-MGC_LOAD
InterPro Glyco_tran_10_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Glyco_tran_10_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Glyco_trans_10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GT10-like_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:60670 UniProtKB/TrEMBL
MGC_CLONE MGC:72456 IMAGE-MGC_LOAD
NCBI Gene 60670 ENTREZGENE
PANTHER ALPHA-(1,3)-FUCOSYLTRANSFERASE 4 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR11929 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Glyco_tran_10_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Glyco_transf_10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Fut4 PhenoGen
RatGTEx ENSRNOG00000009157 RatGTEx
Superfamily-SCOP UDP-Glycosyltransferase/glycogen phosphorylase UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6JN98 ENTREZGENE, UniProtKB/TrEMBL
FUT4_RAT UniProtKB/Swiss-Prot
G3V757 ENTREZGENE, UniProtKB/TrEMBL
Q62994 ENTREZGENE
Q99N88 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-02
Fut4
fucosyltransferase 4
Fut4
fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Fut4
fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
Fut4
fucosyltransferase 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Fut4
fucosyltransferase 4
alpha 1,3-fucosyltransferase Fuc-T (similar to mouse Fut4)
Name updated
1299863 APPROVED
2002-08-07
Fut4
alpha 1,3-fucosyltransferase Fuc-T (similar to mouse Fut4)
Symbol and Name status set to provisional
70820 PROVISIONAL
