Symbol:
Tnfsf4
Name:
TNF superfamily member 4
RGD ID:
619816
Description:
Enables tumor necrosis factor receptor superfamily binding activity. Involved in T cell proliferation; positive regulation of activated T cell proliferation; and positive regulation of interleukin-2 production. Located in cell surface. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
OX40 ligand; Ox40l; Tnlg2b; tumor necrosis factor (ligand) superfamily, member 4; tumor necrosis factor ligand 2b; tumor necrosis factor ligand superfamily member 4; tumor necrosis factor superfamily member 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TNFSF4 (TNF superfamily member 4)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tnfsf4 (tumor necrosis factor (ligand) superfamily, member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tnfsf4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TNFSF4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TNFSF4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnfsf4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TNFSF4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TNFSF4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tnfsf4 (TNF superfamily member 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Tnfsf4 (tumor necrosis factor (ligand) superfamily, member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TNFSF4 (TNF superfamily member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 76,256,654 - 76,280,133 (+) NCBI GRCr8 mRatBN7.2 13 73,723,329 - 73,746,809 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 73,723,329 - 73,746,788 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 76,302,498 - 76,326,020 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 77,600,036 - 77,623,530 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 74,859,914 - 74,883,412 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 79,269,973 - 79,293,775 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 79,269,973 - 79,293,778 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 84,166,838 - 84,190,566 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 77,026,337 - 77,050,223 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 77,040,524 - 77,064,407 (+) NCBI Celera 13 73,499,753 - 73,523,609 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnfsf4 Rat (-)-demecolcine increases expression ISO TNFSF4 (Homo sapiens) 6480464 Demecolcine results in increased expression of TNFSF4 mRNA CTD PMID:23649840 Tnfsf4 Rat 1D-myo-inositol 1,4,5-trisphosphate increases abundance ISO TNFSF4 (Homo sapiens) 6480464 TNFSF4 protein results in increased abundance of Inositol 1 more ... CTD PMID:19416722 Tnfsf4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tnfsf4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFSF4 mRNA CTD PMID:18684927 Tnfsf4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFSF4 mRNA CTD PMID:32109520 Tnfsf4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFSF4 mRNA CTD PMID:20106945 and PMID:21632981 Tnfsf4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tnfsf4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFSF4 mRNA CTD PMID:14718646 and PMID:15972635 Tnfsf4 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of TNFSF4 mRNA CTD PMID:23537331 Tnfsf4 Rat 2-palmitoylglycerol increases expression ISO TNFSF4 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TNFSF4 mRNA CTD PMID:37199045 Tnfsf4 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TNFSF4 mRNA CTD PMID:16997883 Tnfsf4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TNFSF4 mRNA CTD PMID:24780913 Tnfsf4 Rat 8-Br-cAMP multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TNFSF4 mRNA CTD PMID:16997883 Tnfsf4 Rat aflatoxin B1 affects expression ISO TNFSF4 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of TNFSF4 protein CTD PMID:20106945 Tnfsf4 Rat aflatoxin B1 increases expression ISO TNFSF4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TNFSF4 mRNA CTD PMID:21641981 Tnfsf4 Rat all-trans-retinoic acid increases expression ISO TNFSF4 (Homo sapiens) 6480464 Tretinoin results in increased expression of TNFSF4 mRNA CTD PMID:23724009 Tnfsf4 Rat alpha-amanitin affects expression ISO Tnfsf4 (Mus musculus) 6480464 Alpha-Amanitin affects the expression of TNFSF4 mRNA CTD PMID:38531469 Tnfsf4 Rat aluminium hydroxide multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [Ovalbumin co-treated with Aluminum Hydroxide] results in increased expression of TNFSF4 mRNA and nonylphenol promotes the reaction [[Ovalbumin co-treated with Aluminum Hydroxide] results in increased expression of TNFSF4 mRNA] CTD PMID:36029577 Tnfsf4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TNFSF4 mRNA CTD PMID:16483693 Tnfsf4 Rat amphotericin B decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of TNFSF4 mRNA CTD PMID:28534445 Tnfsf4 Rat benzo[a]pyrene decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TNFSF4 mRNA CTD PMID:20064835 more ... Tnfsf4 Rat benzo[a]pyrene affects methylation ISO TNFSF4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TNFSF4 3' UTR CTD PMID:27901495 Tnfsf4 Rat benzo[a]pyrene multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of TNFSF4 mRNA CTD PMID:17690111 Tnfsf4 Rat benzo[b]fluoranthene multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of TNFSF4 mRNA CTD PMID:17690111 Tnfsf4 Rat bis(2-chloroethyl) sulfide increases expression ISO Tnfsf4 (Mus musculus) 6480464 Mustard Gas results in increased expression of TNFSF4 mRNA CTD PMID:19778212 Tnfsf4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of TNFSF4 mRNA CTD PMID:26496021 Tnfsf4 Rat bisphenol A decreases expression ISO TNFSF4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TNFSF4 mRNA CTD PMID:29275510 Tnfsf4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TNFSF4 mRNA CTD PMID:30816183 and PMID:32528016 Tnfsf4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TNFSF4 mRNA CTD PMID:25181051 Tnfsf4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNFSF4 mRNA CTD PMID:27178563 Tnfsf4 Rat Bisphenol B increases expression ISO TNFSF4 (Homo sapiens) 6480464 bisphenol B results in increased expression of TNFSF4 mRNA CTD PMID:32387340 Tnfsf4 Rat bleomycin A2 increases expression ISO Tnfsf4 (Mus musculus) 6480464 Bleomycin results in increased expression of TNFSF4 mRNA CTD PMID:36087614 Tnfsf4 Rat butanal decreases expression ISO TNFSF4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of TNFSF4 mRNA CTD PMID:26079696 Tnfsf4 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of TNFSF4 mRNA CTD PMID:20471445 Tnfsf4 Rat cadmium dichloride decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TNFSF4 mRNA CTD PMID:38382870 Tnfsf4 Rat caffeine increases expression ISO TNFSF4 (Homo sapiens) 6480464 Caffeine results in increased expression of TNFSF4 mRNA CTD PMID:18444173 Tnfsf4 Rat calcipotriol multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [lithol rubine BCA analog results in increased susceptibility to calcipotriene] which results in increased expression of TNFSF4 mRNA and [lithol rubine BCA results in increased susceptibility to calcipotriene] which results in increased expression of TNFSF4 mRNA CTD PMID:29462589 Tnfsf4 Rat carbamazepine affects expression ISO TNFSF4 (Homo sapiens) 6480464 Carbamazepine affects the expression of TNFSF4 mRNA CTD PMID:25979313 Tnfsf4 Rat carbon monoxide multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with Sulfur Dioxide]] which results in increased expression of TNFSF4 mRNA CTD PMID:29621558 Tnfsf4 Rat carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of TNFSF4 mRNA CTD PMID:24911292 Tnfsf4 Rat ceric oxide affects expression EXP 6480464 ceric oxide affects the expression of TNFSF4 mRNA CTD PMID:29463257 Tnfsf4 Rat CGP 52608 multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TNFSF4 gene] CTD PMID:28238834 Tnfsf4 Rat cobalt dichloride decreases expression ISO TNFSF4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TNFSF4 mRNA CTD PMID:19320972 Tnfsf4 Rat copper(II) sulfate decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TNFSF4 mRNA CTD PMID:19549813 Tnfsf4 Rat cyclosporin A decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TNFSF4 mRNA CTD PMID:25562108 Tnfsf4 Rat cyclosporin A increases expression ISO TNFSF4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TNFSF4 mRNA CTD PMID:27989131 Tnfsf4 Rat dexamethasone multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [Dexamethasone co-treated with 8-Bromo Cyclic Adenosine Monophosphate co-treated with 1-Methyl-3-isobutylxanthine] results in decreased expression of TNFSF4 mRNA CTD PMID:16997883 Tnfsf4 Rat Dibutyl phosphate affects expression ISO TNFSF4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TNFSF4 mRNA CTD PMID:37042841 Tnfsf4 Rat disodium selenite decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of TNFSF4 mRNA CTD PMID:18175754 Tnfsf4 Rat dorsomorphin multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TNFSF4 mRNA CTD PMID:27188386 Tnfsf4 Rat epoxiconazole increases expression ISO Tnfsf4 (Mus musculus) 6480464 epoxiconazole results in increased expression of TNFSF4 mRNA CTD PMID:35436446 Tnfsf4 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of TNFSF4 mRNA CTD PMID:31078653 Tnfsf4 Rat ethyl methanesulfonate increases expression ISO TNFSF4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of TNFSF4 mRNA CTD PMID:23649840 Tnfsf4 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of TNFSF4 mRNA CTD PMID:18035473 Tnfsf4 Rat formaldehyde increases expression ISO TNFSF4 (Homo sapiens) 6480464 Formaldehyde results in increased expression of TNFSF4 mRNA CTD PMID:23649840 Tnfsf4 Rat fragrance increases expression ISO TNFSF4 (Homo sapiens) 6480464 Perfume results in increased expression of TNFSF4 mRNA CTD PMID:24768652 Tnfsf4 Rat genistein decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Genistein results in decreased expression of TNFSF4 mRNA CTD PMID:18444173 Tnfsf4 Rat graphite increases expression EXP 6480464 Graphite results in increased expression of TNFSF4 mRNA CTD PMID:29933104 Tnfsf4 Rat hydrogen peroxide increases expression ISO TNFSF4 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of TNFSF4 mRNA CTD PMID:18951874 Tnfsf4 Rat isoflurane decreases expression EXP 6480464 Isoflurane results in decreased expression of TNFSF4 mRNA CTD PMID:16978161 Tnfsf4 Rat leflunomide increases expression ISO TNFSF4 (Homo sapiens) 6480464 leflunomide results in increased expression of TNFSF4 mRNA CTD PMID:28988120 Tnfsf4 Rat lipopolysaccharide decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of TNFSF4 mRNA CTD PMID:31059760 Tnfsf4 Rat methotrexate increases expression ISO TNFSF4 (Homo sapiens) 6480464 Methotrexate results in increased expression of TNFSF4 mRNA CTD PMID:17400583 Tnfsf4 Rat methyl methanesulfonate increases expression ISO TNFSF4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TNFSF4 mRNA CTD PMID:23649840 Tnfsf4 Rat mevalonic acid multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [IFNG results in increased expression of TNFSF4 mRNA]] and Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [IFNG results in increased expression of TNFSF4 protein]] CTD PMID:19589242 Tnfsf4 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of TNFSF4 gene CTD PMID:33148267 Tnfsf4 Rat N-acetyl-L-cysteine multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Particulate Matter results in increased expression of TNFSF4 mRNA] and Acetylcysteine inhibits the reaction [Vehicle Emissions results in increased expression of TNFSF4 mRNA] CTD PMID:20974985 Tnfsf4 Rat nickel atom increases expression ISO TNFSF4 (Homo sapiens) 6480464 Nickel results in increased expression of TNFSF4 mRNA CTD PMID:24768652 Tnfsf4 Rat niclosamide increases expression ISO TNFSF4 (Homo sapiens) 6480464 Niclosamide results in increased expression of TNFSF4 mRNA CTD PMID:36318118 Tnfsf4 Rat Nonylphenol multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 nonylphenol promotes the reaction [[Ovalbumin co-treated with Aluminum Hydroxide] results in increased expression of TNFSF4 mRNA] CTD PMID:36029577 Tnfsf4 Rat O-methyleugenol decreases expression ISO TNFSF4 (Homo sapiens) 6480464 methyleugenol results in decreased expression of TNFSF4 mRNA CTD PMID:32234424 Tnfsf4 Rat p-menthan-3-ol increases expression ISO TNFSF4 (Homo sapiens) 6480464 Menthol results in increased expression of TNFSF4 mRNA CTD PMID:26760959 Tnfsf4 Rat paraquat increases expression ISO Tnfsf4 (Mus musculus) 6480464 Paraquat results in increased expression of TNFSF4 mRNA CTD PMID:22938100 Tnfsf4 Rat pentobarbital decreases expression EXP 6480464 Pentobarbital results in decreased expression of TNFSF4 mRNA CTD PMID:16978161 Tnfsf4 Rat perfluorooctanoic acid increases expression ISO TNFSF4 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of TNFSF4 mRNA CTD PMID:36326898 Tnfsf4 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of TNFSF4 gene CTD PMID:33148267 Tnfsf4 Rat quercetin decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Quercetin results in decreased expression of TNFSF4 mRNA CTD PMID:21632981 Tnfsf4 Rat SB 431542 multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TNFSF4 mRNA CTD PMID:27188386 Tnfsf4 Rat simvastatin multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [IFNG results in increased expression of TNFSF4 mRNA]] more ... CTD PMID:19589242 Tnfsf4 Rat simvastatin decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Simvastatin results in decreased expression of TNFSF4 mRNA and Simvastatin results in decreased expression of TNFSF4 protein CTD PMID:19589242 Tnfsf4 Rat sodium arsenite increases expression ISO TNFSF4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TNFSF4 mRNA CTD PMID:20886546 Tnfsf4 Rat sodium arsenite decreases expression ISO TNFSF4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TNFSF4 mRNA CTD PMID:34032870 Tnfsf4 Rat sodium arsenite affects expression ISO TNFSF4 (Homo sapiens) 6480464 sodium arsenite affects the expression of TNFSF4 mRNA CTD PMID:29319823 Tnfsf4 Rat sulfur dioxide multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with Sulfur Dioxide]] which results in increased expression of TNFSF4 mRNA CTD PMID:29621558 Tnfsf4 Rat tacrine increases expression EXP 6480464 Tacrine results in increased expression of TNFSF4 mRNA CTD PMID:12832660 Tnfsf4 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of TNFSF4 mRNA CTD PMID:26496021 Tnfsf4 Rat thapsigargin increases expression ISO TNFSF4 (Homo sapiens) 6480464 Thapsigargin results in increased expression of TNFSF4 mRNA CTD PMID:22378314 Tnfsf4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TNFSF4 mRNA CTD PMID:33387578 Tnfsf4 Rat triphenyl phosphate affects expression ISO TNFSF4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TNFSF4 mRNA CTD PMID:37042841 Tnfsf4 Rat tris(2-butoxyethyl) phosphate affects expression ISO TNFSF4 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of TNFSF4 mRNA CTD PMID:29024780 Tnfsf4 Rat tunicamycin increases expression ISO TNFSF4 (Homo sapiens) 6480464 Tunicamycin results in increased expression of TNFSF4 mRNA CTD PMID:22378314 Tnfsf4 Rat urethane decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Urethane results in decreased expression of TNFSF4 mRNA CTD PMID:28818685 Tnfsf4 Rat usnic acid increases expression ISO TNFSF4 (Homo sapiens) 6480464 usnic acid results in increased expression of TNFSF4 mRNA CTD PMID:32508146 Tnfsf4 Rat valproic acid affects expression ISO Tnfsf4 (Mus musculus) 6480464 Valproic Acid affects the expression of TNFSF4 mRNA CTD PMID:17292431 Tnfsf4 Rat valproic acid multiple interactions ISO TNFSF4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TNFSF4 mRNA CTD PMID:27188386 Tnfsf4 Rat valproic acid decreases expression ISO TNFSF4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TNFSF4 mRNA CTD PMID:26272509 Tnfsf4 Rat valproic acid affects expression ISO TNFSF4 (Homo sapiens) 6480464 Valproic Acid affects the expression of TNFSF4 mRNA CTD PMID:25979313 Tnfsf4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TNFSF4 mRNA CTD PMID:18629315 Tnfsf4 Rat vincristine increases expression ISO TNFSF4 (Homo sapiens) 6480464 Vincristine results in increased expression of TNFSF4 mRNA CTD PMID:23649840 Tnfsf4 Rat zinc atom multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of TNFSF4 mRNA CTD PMID:12517797 Tnfsf4 Rat zinc(0) multiple interactions ISO Tnfsf4 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of TNFSF4 mRNA CTD PMID:12517797
Imported Annotations - KEGG (archival)
(-)-demecolcine (ISO) 1D-myo-inositol 1,4,5-trisphosphate (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-amanitin (ISO) aluminium hydroxide (ISO) ammonium chloride (EXP) amphotericin B (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bleomycin A2 (ISO) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) calcipotriol (ISO) carbamazepine (ISO) carbon monoxide (ISO) carbon nanotube (EXP) ceric oxide (EXP) CGP 52608 (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) disodium selenite (ISO) dorsomorphin (ISO) epoxiconazole (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) flavonoids (EXP) formaldehyde (ISO) fragrance (ISO) genistein (ISO) graphite (EXP) hydrogen peroxide (ISO) isoflurane (EXP) leflunomide (ISO) lipopolysaccharide (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) mevalonic acid (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (ISO) nickel atom (ISO) niclosamide (ISO) Nonylphenol (ISO) O-methyleugenol (ISO) p-menthan-3-ol (ISO) paraquat (ISO) pentobarbital (EXP) perfluorooctanoic acid (ISO) permethrin (EXP) quercetin (ISO) SB 431542 (ISO) simvastatin (ISO) sodium arsenite (ISO) sulfur dioxide (ISO) tacrine (EXP) testosterone (EXP) thapsigargin (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) tunicamycin (ISO) urethane (ISO) usnic acid (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
acute inflammatory response (IEA,ISO) CD4-positive, alpha-beta T cell costimulation (IEA,ISO) cellular response to lipopolysaccharide (ISO) cellular response to nitrogen dioxide (IEA,ISO) cellular response to prostaglandin E stimulus (ISO) cholesterol metabolic process (IEA,ISO) cytokine production (IMP) defense response to nematode (IEA,ISO) immune response (IEA) inflammatory response (IBA,IEA,ISO) memory T cell activation (IEA,ISO) negative regulation of cytokine production (IEA,ISO) negative regulation of DNA-binding transcription factor activity (ISO) negative regulation of DNA-templated transcription (IEA,ISO) negative regulation of interleukin-17 production (ISO) negative regulation of regulatory T cell differentiation (IEA,ISO) negative regulation of T-helper 1 cell differentiation (IEA,ISO) negative regulation of type II interferon production (IEA,ISO) positive regulation of activated T cell proliferation (IDA) positive regulation of alpha-beta T cell proliferation (IEA,ISO) positive regulation of B cell activation (IEA,ISO) positive regulation of CD4-positive, alpha-beta T cell costimulation (IEA,ISO) positive regulation of CD4-positive, alpha-beta T cell differentiation (IEA,ISO) positive regulation of cell population proliferation (IEA) positive regulation of chemokine production (IEA,ISO) positive regulation of cytokine production (IBA) positive regulation of immunoglobulin mediated immune response (IEA,ISO) positive regulation of immunoglobulin production (IEA,ISO) positive regulation of inflammatory response (ISO) positive regulation of interleukin-10 production (IEA,ISO) positive regulation of interleukin-12 production (IEA,ISO) positive regulation of interleukin-13 production (IEA,ISO) positive regulation of interleukin-2 production (IDA) positive regulation of interleukin-4 production (IEA,ISO) positive regulation of interleukin-4-dependent isotype switching to IgE isotypes (IEA,ISO) positive regulation of interleukin-6 production (IEA,ISO) positive regulation of memory T cell activation (IEA,ISO) positive regulation of memory T cell differentiation (IEA,ISO) positive regulation of T cell costimulation (IEA,ISO) positive regulation of T cell cytokine production (IEA,ISO) positive regulation of T cell proliferation (IBA) positive regulation of T-helper 2 cell activation (IEA,ISO) positive regulation of T-helper 2 cell differentiation (IEA,ISO) positive regulation of type 2 immune response (IEA,ISO) positive regulation of type II interferon production (IEA,ISO) regulation of adaptive immune response (IEA,ISO) regulation of inflammatory response (IEA,ISO) response to nitrogen dioxide (IEA,ISO) response to virus (IEA,ISO) signal transduction (IEA) T cell proliferation (IMP) T-helper 2 cell activation (IEA,ISO)
1.
Identification of rat OX40 ligand by molecular cloning.
Akiba H, etal., Biochem Biophys Res Commun 1998 Oct 9;251(1):131-6.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Revenue sharing: source of more program funds for the disabled and others.
Hammer P and Uhlman TM, Soc Rehabil Rec 1975 Jul-Aug;2(6):28-32.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Characterization of rat OX40 ligand by monoclonal antibody.
Satake Y, etal., Biochem Biophys Res Commun. 2000 Apr 21;270(3):1041-8.
11.
Positional identification of TNFSF4, encoding OX40 ligand, as a gene that influences atherosclerosis susceptibility.
Wang X, etal., Nat Genet. 2005 Apr;37(4):365-72. Epub 2005 Mar 6.
12.
The role of the CD134-CD134 ligand costimulatory pathway in alloimmune responses in vivo.
Yuan X, etal., J Immunol. 2003 Mar 15;170(6):2949-55.
13.
Negative immune factors might predominate local tumor immune status and promote carcinogenesis in cervical carcinoma.
Zhao M, etal., Virol J. 2017 Jan 13;14(1):5. doi: 10.1186/s12985-016-0670-8.
Tnfsf4 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 76,256,654 - 76,280,133 (+) NCBI GRCr8 mRatBN7.2 13 73,723,329 - 73,746,809 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 73,723,329 - 73,746,788 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 76,302,498 - 76,326,020 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 77,600,036 - 77,623,530 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 74,859,914 - 74,883,412 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 79,269,973 - 79,293,775 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 79,269,973 - 79,293,778 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 84,166,838 - 84,190,566 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 77,026,337 - 77,050,223 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 77,040,524 - 77,064,407 (+) NCBI Celera 13 73,499,753 - 73,523,609 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
TNFSF4 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 173,172,870 - 173,450,733 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 173,162,645 - 173,477,583 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 173,152,870 - 173,176,470 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 171,419,493 - 171,443,094 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 169,884,527 - 169,908,128 NCBI Celera 1 146,262,332 - 146,285,933 (-) NCBI Celera Cytogenetic Map 1 q25.1 NCBI HuRef 1 144,377,608 - 144,401,209 (-) NCBI HuRef CHM1_1 1 174,575,344 - 174,598,945 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 172,541,831 - 172,768,144 (-) NCBI T2T-CHM13v2.0
Tnfsf4 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 161,223,009 - 161,245,777 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 161,222,980 - 161,245,981 (+) Ensembl GRCm39 Ensembl GRCm38 1 161,395,438 - 161,418,206 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 161,395,409 - 161,418,410 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 163,325,569 - 163,348,337 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 163,232,135 - 163,254,883 (+) NCBI MGSCv36 mm8 Celera 1 163,843,815 - 163,866,564 (+) NCBI Celera Cytogenetic Map 1 H2.1 NCBI cM Map 1 69.75 NCBI
Tnfsf4 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 13,477,077 - 13,493,309 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 13,477,077 - 13,493,309 (-) NCBI ChiLan1.0 ChiLan1.0
TNFSF4 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 76,255,433 - 76,559,453 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 75,929,208 - 76,396,416 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 148,684,689 - 148,989,775 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 152,391,450 - 152,699,026 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 152,251,683 - 152,262,668 (-) Ensembl panpan1.1 panPan2 PanPan1.1 Ensembl 1 152,391,450 - 152,415,845 (-) Ensembl panpan1.1 panPan2
TNFSF4 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 25,883,297 - 25,909,608 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 25,883,251 - 25,906,892 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 25,415,436 - 25,441,738 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 25,634,585 - 25,660,879 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 25,634,528 - 25,660,603 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 25,553,133 - 25,579,437 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 25,626,526 - 25,652,838 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 25,780,205 - 25,806,523 (+) NCBI UU_Cfam_GSD_1.0
Tnfsf4 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
TNFSF4 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 115,550,569 - 115,659,263 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 115,535,185 - 115,857,457 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 127,042,208 - 127,049,271 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TNFSF4 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 55,714,291 - 55,998,009 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 55,974,691 - 55,997,374 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 57,291,046 - 57,591,856 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnfsf4 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 149 Count of miRNA genes: 110 Interacting mature miRNAs: 128 Transcripts: ENSRNOT00000003969 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 8655951 Rf63 Renal function QTL 63 12.2 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 13 69060519 77046890 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
6
16
93
37
46
19
25
19
4
116
47
85
36
45
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003969 ⟹ ENSRNOP00000003969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 73,723,329 - 73,746,788 (+) Ensembl Rnor_6.0 Ensembl 13 79,269,973 - 79,293,778 (+) Ensembl
RefSeq Acc Id:
NM_053552 ⟹ NP_446004
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 76,256,654 - 76,280,133 (+) NCBI mRatBN7.2 13 73,723,329 - 73,746,809 (+) NCBI Rnor_6.0 13 79,269,973 - 79,293,775 (+) NCBI Rnor_5.0 13 84,166,838 - 84,190,566 (+) NCBI RGSC_v3.4 13 77,026,337 - 77,050,223 (+) RGD Celera 13 73,499,753 - 73,523,609 (+) RGD
Sequence:
GGCACGAGCTTCAATTGCCTTTTGTCTCCGGTTCTGGGACCTTTGTCTTCTGACCCACAGGCTTGGCTTCACCCTTGTCTTCTCCTTTGTGGTGAAGAGCAGCCTTCCCCAGGCTCCCCTTTGCCACG GCTGTGCCTTCTCTGCACCCTGACTTCGAGCATGGAAGGGGAAGGGGTTCAACCCCCGGATGAGAATCTGGAAAATGGATCAAGGCCAAGGTTCAAGTGGAAGAAGGTGCTAAGGCTGGTGGTCTCTG GGATTAAGGCAGCAGGGCTGCTCCTGTGCGTCGTCTATGTCTGCCTGCAATTCTCTTCATCTCCGGCGAAGGACTCTCCAATCCAAAGACTCAGAGCACCAGTTACCGGATGTGAGGGGGGAAGACTA TTCATTGGCACATCCAAGAATGAGTATGAAACCATGGAGGTGCAGAACAATTCGGTCATCATCAACTGCGATGGGCTTTATCTCATCCACCTGAAGGGCTCCTTTTTCCAGGAGGTCAAGATCAACCT TCATTTCCGGAAGGATCGCAGTCCAATCTTTGTGCCAATGCTGAACAATGGTCAAAGGGTTGTTTTCACTGTGGTGACCTCTTTGGCTTTTAAAGACGAAGTTTACTTGACTGTAAATGCTTCTGATA CTCTCTGTGAACACCTCCAGATAAATGATGGGGAACTGATTATTGTCCAGCTAACTCCTAATGGATACTGTGCTCCTGAAAGACCTTATAGCAGCACTGTGAACCAAGTACCACTGTGAATTCCACTC TGAGGGTGGACAGGACACAGGTTCTTTCTTGCGAGAGATGAGTCCATCCTGCTCAACTCCATGACATGTGATGGAATGCAGATCCCACCCCACTTCCTCACTCAGGGATATTTAAGTCGTGTCTTACA TAACAGTTGACCTCTCATTCCCAGGATTGCCTAGAGTCTGCTAAGAGCTCTACAGGGAATGAAAAAAATAAATGTCTCTTCAAGATGCATTGTTTCAGTTGGTCAGAAGATCATTGTAATAAACATCT GACACTGAAAATGGGGCTTGATTATTATCTTCTAGAATTTTGACATTGTCAAAAGAAAGAACTAAGAATGGGACTGTGAGTCTGGAAAGGGTGGTGTCTACCAGCCAGTAGGAGCTGGAGTGCTCTAT TCAAGGTTAAGGTGATAGACAACTGTTTAGGTGATGAGGTGATGTATACTGTGAGCTTCTCCCATTATCTCTCTTCTTTCCTGGCCTCCAAATATACATAATAGAAAACGTCCTTCAAAGAGCTATCT AGGATGATACCACCGAGTACTGCATCAGTGATGTAAAGAAAACCAGTAGAGCTTTGTTTGTTATACAGAGCATAGGAGAGATTTTACCCCAACAGTTATTTTTATAATCTAGGATAATAGTGAACTGA ATGTCGCAGGATAAAGGTCAAGAAGGGTTTTGACAGTCTAAGCAAGACTGTTTTCCAAGTTCTCTTTTCCAATATTTTATGTAAATCTTTGATAATTTAAAAATTTTTAGTATTTTTTGGCCATTTTC AATAGAAAATATAGCTCAAACTATTTCCAGATGACTTCATATCCCCATAAGGATTATATTGTGTTACAATACAGTGCGTATGTCTTGAACCTCCAGAAAGTCTGAAGGCTACTAATCCTTATACTAAG TGAATTCAGTTACATTTGGAATTTTTTGTCTGATAGTATATTTTCTCTTATGCATCTATCTATACTTCTATGTACCCTCTGTTTTAATCTGTTATTAAAAGAAGCCAAATAAAAATGCTACATAAAAA AAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_446004 ⟸ NM_053552
- UniProtKB:
Q9Z2P3 (UniProtKB/Swiss-Prot), A0A0U5JAD2 (UniProtKB/TrEMBL)
- Sequence:
MEGEGVQPPDENLENGSRPRFKWKKVLRLVVSGIKAAGLLLCVVYVCLQFSSSPAKDSPIQRLRAPVTGCEGGRLFIGTSKNEYETMEVQNNSVIINCDGLYLIHLKGSFFQEVKINLHFRKDRSPIF VPMLNNGQRVVFTVVTSLAFKDEVYLTVNASDTLCEHLQINDGELIIVQLTPNGYCAPERPYSSTVNQVPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000003969 ⟸ ENSRNOT00000003969
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-21
Tnfsf4
TNF superfamily member 4
Tnfsf4
tumor necrosis factor superfamily member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-11-25
Tnfsf4
tumor necrosis factor superfamily member 4
Tnfsf4
tumor necrosis factor (ligand) superfamily, member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-20
Tnfsf4
tumor necrosis factor (ligand) superfamily, member 4
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Tnfsf4
tumor necrosis factor (ligand) superfamily, member 4
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to the cell surface
634509
gene_protein
199 amino acids
634509