Advanced Search (OLGA)

Gene: Pde3a (phosphodiesterase 3A) Rattus norvegicus

Analyze

Symbol:

Pde3a

Name:

phosphodiesterase 3A

RGD ID:

61942

Description:

Predicted to enable 3',5'-cyclic-nucleotide phosphodiesterase activity; estrogen binding activity; and nuclear estrogen receptor activity. Involved in negative regulation of apoptotic process; negative regulation of cAMP/PKA signal transduction; and oocyte maturation. Predicted to be located in membrane. Predicted to be active in cytosol. Biomarker of obesity and pulmonary hypertension. Human ortholog(s) of this gene implicated in hypertension and brachydactyly syndrome. Orthologous to human PDE3A (phosphodiesterase 3A); PARTICIPATES IN protein kinase A (PKA) signaling pathway; insulin signaling pathway; purine metabolic pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CGI-PDE A; cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A; cGMP-inhibited 3',5'-cyclic phosphodiesterase A; cyclic GMP-inhibited phosphodiesterase A; cyclic nucleotide phosphodiesterase; phosphodiesterase 3A cGMP inhibited; phosphodiesterase 3A, cGMP inhibited; RNPDE3A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDE3A (phosphodiesterase 3A)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pde3a (phosphodiesterase 3A, cGMP inhibited)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pde3a (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDE3A (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDE3A (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pde3a (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDE3A (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDE3A (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pde3a (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pde3a (phosphodiesterase 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRSS23 (serine protease 23)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pde3a (phosphodiesterase 3A, cGMP inhibited)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PDE3A (phosphodiesterase 3A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pde3a (phosphodiesterase 3A, cGMP-inhibited)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pde-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pde-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pde3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Pde3a^em1Bdr ; Pde3a^em2Bdr ; Pde3a^em3Bdr

Genetic Models:

SD-Pde3a^em1Bdr ; SD-Pde3a^em3Bdr ; SD-Pde3a^em2Bdr

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	175,904,276 - 176,170,531 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	175,904,077 - 176,169,270 (+)	Ensembl				GRCr8
mRatBN7.2	4	174,172,804 - 174,443,944 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	174,172,868 - 174,438,274 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	180,468,046 - 180,732,053 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	176,252,313 - 176,516,321 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	174,872,874 - 175,136,859 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	175,431,904 - 175,703,844 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	175,431,904 - 175,700,238 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	239,659,270 - 239,921,900 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	178,658,896 - 178,930,417 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	162,714,211 - 162,977,642 (+)	NCBI		Celera
RGSC_v3.1	4	178,904,019 - 179,175,541 (+)	NCBI
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

hypertension and brachydactyly syndrome (ISO)

Left Ventricular Hypertrophy (IEP)

myocardial infarction (ISO)

obesity (IEP)

prostate cancer (ISO)

pulmonary hypertension (IEP)

stroke (ISO)

thrombosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

dextran sulfate (ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

FR900359 (ISO)

ivermectin (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methoxychlor (EXP)

N(4)-hydroxycytidine (ISO)

N,N-diethyl-m-toluamide (EXP)

nickel sulfate (ISO)

okadaic acid (ISO)

Olprinone hydrochloride (ISO)

ozone (ISO)

panobinostat (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (EXP)

permethrin (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

roflumilast (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

testosterone (EXP,ISO)

testosterone enanthate (EXP)

Theaflavin 3,3'-digallate (ISO)

theophylline (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

valsartan (EXP)

vinclozolin (EXP)

vorinostat (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic signaling pathway (IEA,ISO,ISS)

cellular response to cGMP (IEA,ISO)

cellular response to transforming growth factor beta stimulus (IEA,ISO)

negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO)

negative regulation of apoptotic process (IMP)

negative regulation of cAMP/PKA signal transduction (IBA,IEA,IMP)

negative regulation of vascular permeability (IEA,ISO)

nuclear receptor-mediated steroid hormone signaling pathway (IEA)

oocyte maturation (IEP,ISO,TAS)

positive regulation of oocyte development (ISO)

positive regulation of vascular permeability (IEA,ISO)

regulation of meiotic nuclear division (ISO)

regulation of ribonuclease activity (ISO,ISS)

response to xenobiotic stimulus (ISO)

signal transduction (IEA)

Cellular Component

cytosol (IBA,IEA,ISO)

membrane (IEA,ISO)

Molecular Function

3',5'-cGMP-inhibited cyclic-nucleotide phosphodiesterase activity (IEA,ISO)

3',5'-cyclic-AMP phosphodiesterase activity (IBA,IEA,ISO)

3',5'-cyclic-GMP phosphodiesterase activity (IBA,IEA,ISO)

3',5'-cyclic-nucleotide phosphodiesterase activity (IEA,ISO)

cyclic-nucleotide phosphodiesterase activity (IEA,TAS)

estrogen binding (IEA,ISO,ISS)

hydrolase activity (IEA)

metal ion binding (IEA)

nuclear estrogen receptor activity (IEA,ISO)

phosphoric diester hydrolase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin signaling pathway (IEA)

protein kinase A (PKA) signaling pathway (ISO)

purine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Biochemistry and physiology of cyclic nucleotide phosphodiesterases: essential components in cyclic nucleotide signaling.	Conti M and Beavo J, Annu Rev Biochem. 2007;76:481-511.
2.	Functional role of phosphodiesterase 3 in cardiomyocyte apoptosis: implication in heart failure.	Ding B, etal., Circulation. 2005 May 17;111(19):2469-76. Epub 2005 May 2.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Expression of cyclic GMP-inhibited phosphodiesterases 3A and 3B (PDE3A and PDE3B) in rat tissues: differential subcellular localization and regulated expression by cyclic AMP.	Liu H and Maurice DH, Br J Pharmacol. 1998 Dec;125(7):1501-10.
7.	Alterations in EDHF-type relaxation and phosphodiesterase activity in mesenteric arteries from diabetic rats.	Matsumoto T, etal., Am J Physiol Heart Circ Physiol. 2003 Jul;285(1):H283-91.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Increased expression of the cGMP-inhibited cAMP-specific (PDE3) and cGMP binding cGMP-specific (PDE5) phosphodiesterases in models of pulmonary hypertension.	Murray F, etal., Br J Pharmacol. 2002 Dec;137(8):1187-94.
10.	Cyclic nucleotide phosphodiesterase 3 expression in vivo: evidence for tissue-specific expression of phosphodiesterase 3A or 3B mRNA and activity in the aorta and adipose tissue of atherosclerosis-prone insulin-resistant rats.	Nagaoka T, etal., Diabetes. 1998 Jul;47(7):1135-44.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Altered phosphodiesterase 3-mediated cAMP hydrolysis contributes to a hypermotile phenotype in obese JCR:LA-cp rat aortic vascular smooth muscle cells: implications for diabetes-associated cardiovascular disease.	Netherton SJ, etal., Diabetes. 2002 Apr;51(4):1194-200.
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Role of phosphodiesterase type 3A in rat oocyte maturation.	Richard FJ, etal., Biol Reprod 2001 Nov;65(5):1444-51.
19.	Vascular smooth muscle cell phosphodiesterase (PDE) 3 and PDE4 activities and levels are regulated by cyclic AMP in vivo.	Tilley DG and Maurice DH, Mol Pharmacol. 2002 Sep;62(3):497-506.
20.	cGMP-phosphodiesterase activity is up-regulated in response to pressure overload of rat ventricles.	Yanaka N, etal., Biosci Biotechnol Biochem. 2003 May;67(5):973-9.

Additional References at PubMed

PMID:9631240	PMID:11420239	PMID:17704206	PMID:18571642	PMID:19252089	PMID:19474061	PMID:21224496	PMID:23008439	PMID:27975297	PMID:28755400	PMID:31401933	PMID:32524868
PMID:36259389	PMID:37296663

Genomics

Comparative Map Data

Pde3a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	175,904,276 - 176,170,531 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	175,904,077 - 176,169,270 (+)	Ensembl				GRCr8
mRatBN7.2	4	174,172,804 - 174,443,944 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	174,172,868 - 174,438,274 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	180,468,046 - 180,732,053 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	176,252,313 - 176,516,321 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	174,872,874 - 175,136,859 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	175,431,904 - 175,703,844 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	175,431,904 - 175,700,238 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	239,659,270 - 239,921,900 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	178,658,896 - 178,930,417 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	162,714,211 - 162,977,642 (+)	NCBI		Celera
RGSC_v3.1	4	178,904,019 - 179,175,541 (+)	NCBI
Cytogenetic Map	4	q44	NCBI

PDE3A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	20,368,537 - 20,688,583 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	20,368,537 - 20,688,583 (+)	Ensembl			hg38	GRCh38
GRCh37	12	20,521,471 - 20,841,517 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	20,413,464 - 20,725,148 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	20,413,485 - 20,725,646	NCBI
Celera	12	25,677,589 - 25,989,565 (+)	NCBI		Celera
Cytogenetic Map	12	p12.2	NCBI
HuRef	12	20,294,054 - 20,609,054 (+)	NCBI		HuRef
CHM1_1	12	20,487,485 - 20,802,952 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	20,246,943 - 20,567,173 (+)	NCBI		T2T-CHM13v2.0

Pde3a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	141,194,995 - 141,452,588 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	141,194,995 - 141,453,174 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	141,249,269 - 141,506,862 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	141,249,269 - 141,507,448 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	141,197,790 - 141,447,872 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	141,211,675 - 141,461,757 (+)	NCBI		MGSCv36	mm8
Celera	6	144,313,875 - 144,561,276 (+)	NCBI		Celera
Cytogenetic Map	6	G2	NCBI
cM Map	6	71.87	NCBI

Pde3a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	16,340,918 - 16,643,214 (+)	Ensembl
ChiLan1.0	NW_004955413	16,340,827 - 16,642,731 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDE3A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	25,825,418 - 26,141,755 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	25,821,163 - 26,138,472 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	20,380,213 - 20,690,540 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	20,763,999 - 21,068,229 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	20,763,999 - 21,064,391 (+)	Ensembl			panPan2	panpan1.1

PDE3A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	26,555,558 - 26,878,624 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	26,560,547 - 26,878,913 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	19,575,517 - 19,894,064 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	26,888,527 - 27,207,815 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	26,892,255 - 27,208,226 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	26,750,810 - 27,069,537 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	26,736,440 - 27,052,773 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	19,282,366 - 19,598,748 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pde3a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	87,831,481 - 88,147,727 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936548	5,762,507 - 6,070,576 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936548	5,758,634 - 6,072,195 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDE3A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	52,409,882 - 52,738,406 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	52,413,503 - 52,737,771 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	55,777,634 - 55,969,591 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDE3A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	20,235,814 - 20,545,740 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	20,236,430 - 20,540,900 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	14,610,757 - 14,913,649 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pde3a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	17,781,647 - 17,829,771 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	17,773,803 - 18,088,611 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pde3a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	8,075,290 - 8,341,783 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pde3a
1151 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	26
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000032843
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat

Markers in Region

BE120043

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	174,389,595 - 174,389,797 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	175,652,674 - 175,652,875	NCBI	Rnor6.0
Rnor_5.0	4	239,874,014 - 239,874,215	UniSTS	Rnor5.0
RGSC_v3.4	4	178,882,296 - 178,882,497	UniSTS	RGSC3.4
Celera	4	162,930,163 - 162,930,364	UniSTS
RH 3.4 Map	4	1042.6	UniSTS
Cytogenetic Map	4	q44	UniSTS

RH141641

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	174,290,216 - 174,290,396 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	175,553,287 - 175,553,466	NCBI	Rnor6.0
Rnor_5.0	4	239,774,923 - 239,775,102	UniSTS	Rnor5.0
RGSC_v3.4	4	178,780,737 - 178,780,916	UniSTS	RGSC3.4
Celera	4	162,830,756 - 162,830,935	UniSTS
RH 3.4 Map	4	1035.5	UniSTS
Cytogenetic Map	4	q44	UniSTS

Genetic Models

This gene Pde3a is modified in the following models/strains:

SD-Pde3a^em1Bdr SD-Pde3a^em3Bdr SD-Pde3a^em2Bdr

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	90	59	6	354	190	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U38179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032843 ⟹ ENSRNOP00000032282

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	175,904,077 - 176,169,270 (+)	Ensembl
mRatBN7.2 Ensembl	4	174,172,868 - 174,438,274 (+)	Ensembl
Rnor_6.0 Ensembl	4	175,431,904 - 175,700,238 (+)	Ensembl

RefSeq Acc Id:

NM_017337 ⟹ NP_059033

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	175,904,276 - 176,168,269 (+)	NCBI
mRatBN7.2	4	174,173,193 - 174,437,158 (+)	NCBI
Rnor_6.0	4	175,431,904 - 175,700,238 (+)	NCBI
Rnor_5.0	4	239,659,270 - 239,921,900 (+)	NCBI
RGSC_v3.4	4	178,658,896 - 178,930,417 (+)	RGD
Celera	4	162,714,211 - 162,977,642 (+)	RGD

Sequence:

show sequence

ATGGCAGTGCGGGGCGAGGCCGCCCAAGACTGGGCCAAGCCCGGTCTCCGAGGGCCGAGTCCTG
CCCCGGTGGCCAGAGGGGACCACCGCTGTCGTGGCGGGTCCCCTTCATCCCCTCGGGGCTCGGG
CTGTTGTTGGCGAGCCCTGGCGTTGCAGCCTCTCCGGCGCTCGCCGCAACTCTCCTCCGCGTTG
TGCGCGGGCTCCCTGTCCGTGCTGCTGGCGCTGCTGGTGAGGCTGGTCGGCGGGGAGGTCGGAG
GCGAGCTGGAGTCGAGTCAGGAGGCGGCGGCCGAGGAGGAGGAGGAGGAAGGAGCCCGAGGGGG
CGTCTTCCCGGGCCCTCGGGGAGGTGCTCCCGGGGGCGGCGCGCAGCTCAGCCCTTGGCTGCAG
CCGGCCGCGCTGCTCTTCAGTCTCCTGTGCGCCTTCTTCTGGATGGGCTTGTGCCTGCTGCGCG
CCGGGGTGCGCCTGCCTCTGGCCGTCGCGCTGTTGGCCGCCTGCTGCGCCGGGGAAGCGCTGGT
GCAGCTCTCCTTGGGCGTGGGGGACGGTCGCCTGCTGTCGCTACCCGCCGCGGGGGTCCTGCTC
AGCTGCCTAGGTGGCGCGACATGGCTGGTGCTGAGGCTGAGGCTGGGCGTCCTCATGGTCGCTT
TGACTAGCGCCCTCAGGACGGTGGCCCTGGTTTCTCTGGAGAGGTTCAAGGTCGCCTGGAGACC
TTACCTGGCATACTTGGCGGCCGTGCTTGGGCTGCTGCTGGCCAGGTACGCCGAGCAGCTCCTG
CCGCAGTGCTCCGGGCCGGCTCCGCCCAGGGAGCGGTTTGGGTCCCAGTCGAGCGCGAGGACCA
AGGAAGAGATTCCGGGGTGGAAGAGGAGGAGGCGGTCCAGCTCGGTGGTGGCCGGCGAGATGTC
CGGCTGCGGTGGCAAGTCTCACCGGAGGACCTCCCTGCCCTGCATACCCAGGGAGCAGCTCATG
GGCCATTCAGAATGGGACCACAAGAGAGGGTCACGAGGATCCCAGTCAGGAACCAGCGTCACCG
TGGATATTGCCGTGATGGGCGAGGCGCATGGCCTCATTACCGACCTCCTGGCCGACCCTTCTTT
GCCTCCGAATGTGTGCACGTCCTTGAGGGCCGTGAGCAACCTGCTCAGTACCCAGCTCACCTTC
CAGGCAATCCACAAGCCCAGAGTGAACCCCACTGTGACCTTCAGTGAGAACTATACCTGCTCCG
ACTCTGAGGAAGGCTTGGAGAAAGACAAGCTGGCCATTCCCAAGCGCCTGAGAAGAAGTTTGCC
TCCAGGCTTGCTGAGGAGAGTTTCATCAACTTGGACAACTACCACCTCTGCCACAGGACTGCCT
ACCTTGGAGCCTGCGCCAGTGCGGAGGGACCGCAGCGCCAGCATAAAGCCACATGAAGCCCCTT
CACCCAGTGCTGTCAACCCTGACTCTTGGAATGCCCCAGTGTTGATGACTCTAACCAAAAGCAG
GTCCTTCACTTCGTCCTATGCTGTCTCTGCAGCTAACCACGTCAAAGCTAAAAAGCAAAACAGG
CCAGGTGGCCTTGATAAGATTTCGCCCGTTCCCTCGCCCTCCTCCTCACCTCCTCAAGGATCAC
CCACCAGCAGTCCTGTCAGTGGCATTGCTTCCGTACAGTTCCCGGAATCCCCTGAAGTCACCAC
CAAACGAGGCCCTGGATCTCACAGGGCCTTAACTTACACCCAGAGTGCCCCTGACCTGTCCCCC
CAGATCCCGCCCTCACCTGTCATATGTAGCAGCTGTGGCAGACCTTACTCACAAGGGAATCCTG
CTGATGGACCTTCAGAGAGAAGTGGCCCAGCCATGCAGAAACCAAACAGAACAGATGATACTTC
TCAAGTTACCTCTGATTATGAGACCAACAACAACAGTGACAGCAGCGACATCCTGCAGAATGAT
GAGGAAGCCGAGTGCCAGAGAGAGCCACTGAGGAAAGCATCGGCTTGTGGCACCTATACTCCCC
AGACCATGATCTTCCTGGACAAACCAATTCTTGCTCCAGAACCCCTGGTCATGGATAACCTGGA
TTCAATTATGGATCAGTTGAACACCTGGAATTTTCCAATTTTTGATTTAGTGGAAAACATAGGA
AGAAAATGTGGCCGTATTCTGAGCCAGGTGTCATACAGACTCTTTGAAGACATGGGGCTCTTTG
AAGCCTTTAAAATCCCGGTTAGGGAGTTTATGAATTACTTTCATGCTTTGGAGATCGGCTACAG
GGACATTCCTTATCATAACAGAATCCACGCCACTGATGTTTTGCACGCCGTGTGGTATCTCACA
ACACAGCCGATTCCTGGCCTCCCGAGTGTGATTGGTGATCACGGCTCGGCAAGTGACTCTGATT
CTGACAGTGGGTTTACACACGGACACATGGGATATGTGTTTTCCAAAGCGTATCATGTGCCAGA
TGACAAATATGGATGCCTGTCTGGAAATATTCCAGCCCTGGAGTTGATGGCCCTGTATGTTGCT
GCAGCCATGCATGACTACGATCACCCAGGAAGGACAAATGCTTTCCTGGTTGCCACTAGCGCCC
CTCAGGCCGTGCTGTACAATGACCGTTCCGTTCTGGAGAACCATCACGCAGCTGCAGCCTGGAA
TCTCTTCATGTCCCGGCCGGAGTATAACTTCTTAGTTAACCTGGACCATGTGGAATTTAAGCAC
TTCCGATTCCTAGTCATTGAAGCAATTCTGGCTACTGACCTGAAGAAACACTTTGACTTTGTAG
CCAAGTTTAATGCCAAGGTGAATGATGATGTTGGGATAGATTGGACCAATGAAAACGACCGTCT
CCTGGTGTGTCAGATGTGTATAAAGTTGGCTGACATCAACGGGCCTGCTAAATGTAAGGACCTC
CACCTGCGGTGGACGGAGGGCATCGCCAGCGAGTTTTATGAGCAGGGCGATGAAGAAGCCAGCC
TTGGTTTGCCCATAAGCCCATTTATGGACCGCTCTGCCCCGCAGCTGGCCAATCTTCAGGAGTC
CTTTATCTCACACATCGTGGGTCCTCTTTGCCACTCCTACGACTCTGCGGGTCTCATGCCGGGA
AAATGGGTAGATGACAGTGATGATTCAGGAGACACTGATGACCCGGAAGAAGAGGAGGAAGAGG
CTGAAACACCACACGAGGAAGAAACCTGTGAAAACAGTGAAGCTCCCAGAAAGAAAAGTTTCAA
AAGAAGGAGAATCTACTGTCAAATAACTCAGCACCTTCTGCAGAACCACATGATGTGGAAGAAA
GTGATTGAAGAGGAGCAGTGTTTATCAGGCACAGAGAACCAGGCCCCAGACCAGGCACCGCTGC
AGCATTCCTCAGAACAAATCCAGGCTATCAAGGAGGAGGAGGAAGAGAAGGGGAAGCCAAGAGC
AGAGGAAACCCTCGCTCCACAACCAGACCTGTGA

hide sequence

RefSeq Acc Id:

XM_063286623 ⟹ XP_063142693

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	175,994,397 - 176,170,531 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_059033	(Get FASTA)	NCBI Sequence Viewer
	XP_063142693	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA84964	(Get FASTA)	NCBI Sequence Viewer
	EDM01550	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032282
	ENSRNOP00000032282.1
GenBank Protein	Q62865	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_059033 ⟸ NM_017337

- UniProtKB:

Q62865 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAVRGEAAQDWAKPGLRGPSPAPVARGDHRCRGGSPSSPRGSGCCWRALALQPLRRSPQLSSAL
CAGSLSVLLALLVRLVGGEVGGELESSQEAAAEEEEEEGARGGVFPGPRGGAPGGGAQLSPWLQ
PAALLFSLLCAFFWMGLCLLRAGVRLPLAVALLAACCAGEALVQLSLGVGDGRLLSLPAAGVLL
SCLGGATWLVLRLRLGVLMVALTSALRTVALVSLERFKVAWRPYLAYLAAVLGLLLARYAEQLL
PQCSGPAPPRERFGSQSSARTKEEIPGWKRRRRSSSVVAGEMSGCGGKSHRRTSLPCIPREQLM
GHSEWDHKRGSRGSQSGTSVTVDIAVMGEAHGLITDLLADPSLPPNVCTSLRAVSNLLSTQLTF
QAIHKPRVNPTVTFSENYTCSDSEEGLEKDKLAIPKRLRRSLPPGLLRRVSSTWTTTTSATGLP
TLEPAPVRRDRSASIKPHEAPSPSAVNPDSWNAPVLMTLTKSRSFTSSYAVSAANHVKAKKQNR
PGGLDKISPVPSPSSSPPQGSPTSSPVSGIASVQFPESPEVTTKRGPGSHRALTYTQSAPDLSP
QIPPSPVICSSCGRPYSQGNPADGPSERSGPAMQKPNRTDDTSQVTSDYETNNNSDSSDILQND
EEAECQREPLRKASACGTYTPQTMIFLDKPILAPEPLVMDNLDSIMDQLNTWNFPIFDLVENIG
RKCGRILSQVSYRLFEDMGLFEAFKIPVREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLT
TQPIPGLPSVIGDHGSASDSDSDSGFTHGHMGYVFSKAYHVPDDKYGCLSGNIPALELMALYVA
AAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKH
FRFLVIEAILATDLKKHFDFVAKFNAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKDL
HLRWTEGIASEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCHSYDSAGLMPG
KWVDDSDDSGDTDDPEEEEEEAETPHEEETCENSEAPRKKSFKRRRIYCQITQHLLQNHMMWKK
VIEEEQCLSGTENQAPDQAPLQHSSEQIQAIKEEEEEKGKPRAEETLAPQPDL

hide sequence

Ensembl Acc Id:

ENSRNOP00000032282 ⟸ ENSRNOT00000032843

RefSeq Acc Id:	XP_063142693 ⟸ XM_063286623
- Peptide Label:	isoform X1

Protein Domains

PDEase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62865-F1-model_v2	AlphaFold	Q62865	1-1141	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61942	AgrOrtholog
BioCyc Gene	G2FUF-42515	BioCyc
Ensembl Genes	ENSRNOG00000025042	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000032843	ENTREZGENE
	ENSRNOT00000032843.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.1300.10	UniProtKB/Swiss-Prot
InterPro	HD/PDEase_dom	UniProtKB/Swiss-Prot
	PDEase_catalytic_dom	UniProtKB/Swiss-Prot
	PDEase_catalytic_dom_sf	UniProtKB/Swiss-Prot
	PDEase_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:50678	UniProtKB/Swiss-Prot
NCBI Gene	Pde3a	ENTREZGENE
PANTHER	CYCLIC NUCLEOTIDE PHOSPHODIESTERASE	UniProtKB/Swiss-Prot
Pfam	PDEase_I	UniProtKB/Swiss-Prot
PhenoGen	Pde3a	PhenoGen
PROSITE	PDEASE_I_1	UniProtKB/Swiss-Prot
	PDEASE_I_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000025042	RatGTEx
SMART	HDc	UniProtKB/Swiss-Prot
Superfamily-SCOP	HD-domain/PDEase-like	UniProtKB/Swiss-Prot
UniProt	A6IMN9_RAT	UniProtKB/TrEMBL
	PDE3A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Pde3a	phosphodiesterase 3A	Pde3a	phosphodiesterase 3A, cGMP inhibited	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Pde3a	phosphodiesterase 3A, cGMP inhibited	Pde3a	phosphodiesterase 3A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pde3a	phosphodiesterase 3A			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)