Advanced Search (OLGA)

Gene: Ramp3 (receptor activity modifying protein 3) Rattus norvegicus

Analyze

Symbol:

Ramp3

Name:

receptor activity modifying protein 3

RGD ID:

61873

Description:

Enables coreceptor activity. Predicted to be involved in several processes, including G protein-coupled receptor signaling pathway; positive regulation of intracellular signal transduction; and positive regulation of macromolecule metabolic process. Predicted to act upstream of or within adenylate cyclase-activating G protein-coupled receptor signaling pathway; adrenomedullin receptor signaling pathway; and amylin receptor 3 signaling pathway. Predicted to be located in lysosome and plasma membrane. Predicted to be part of adrenomedullin receptor complex and amylin receptor complex 3. Predicted to be active in cell surface. Orthologous to human RAMP3 (receptor activity modifying protein 3); INTERACTS WITH (S)-nicotine; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

receptor (calcitonin) activity modifying protein 3; receptor (G protein-coupled) activity modifying protein 3; receptor activity-modifying protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	85,741,314 - 85,758,813 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	85,755,211 - 85,758,818 (+)	Ensembl				GRCr8
mRatBN7.2	14	81,527,404 - 81,544,905 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	81,527,385 - 81,544,902 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	85,928,688 - 85,946,185 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	87,168,498 - 87,186,001 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	83,618,093 - 83,635,590 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	86,922,223 - 86,939,722 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	86,922,223 - 86,939,719 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	80,555,482 - 80,572,981 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	87,417,290 - 87,434,789 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	80,409,008 - 80,426,508 (+)	NCBI		Celera
RGSC_v3.1	14	87,436,434 - 87,453,933 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colorectal cancer (ISO)

Lymphatic Metastasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP,ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aldehydo-D-glucose (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

amphotericin B (ISO)

atrazine (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

calciol (EXP)

carbon nanotube (ISO)

chloroprene (ISO)

chrysene (ISO)

D-glucose (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

ethanol (ISO)

furan (EXP)

glucose (ISO)

hydralazine (EXP)

hydrochlorothiazide (EXP)

hydrogen cyanide (ISO)

indole-3-methanol (EXP)

inulin (ISO)

isoprenaline (EXP)

methimazole (EXP)

methoxychlor (EXP)

morphine (ISO)

N(gamma)-nitro-L-arginine methyl ester (EXP)

nicotine (EXP,ISO)

nitric oxide (EXP)

oxaliplatin (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

pirinixic acid (ISO)

potassium cyanide (ISO)

progesterone (ISO)

sodium arsenate (ISO)

sulfadimethoxine (EXP)

testosterone (EXP)

tetrachloromethane (EXP)

tetraphene (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO,NAS)

adrenomedullin receptor signaling pathway (IEA,ISO,NAS)

amylin receptor 3 signaling pathway (IEA,ISO)

amylin receptor signaling pathway (IEA,ISO)

calcium ion transport (IBA,IEA,ISO)

cellular response to estradiol stimulus (IEA,ISO,ISS)

cellular response to hormone stimulus (IBA)

G protein-coupled receptor signaling pathway (IBA,ISO)

G protein-coupled receptor signaling pathway involved in heart process (IEA,ISO,ISS)

intracellular protein transport (IEA)

positive regulation of calcium-mediated signaling (IEA,ISO)

positive regulation of cAMP/PKA signal transduction (IEA,ISO)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO)

positive regulation of protein localization to plasma membrane (IEA,ISO,ISS)

positive regulation of receptor recycling (IEA,ISO)

protein localization to plasma membrane (IBA,IEA,ISO)

protein transport (IBA,IEA,ISO)

receptor internalization (IBA,IEA,ISO)

regulation of G protein-coupled receptor signaling pathway (IEA)

response to amyloid-beta (IEA,ISO)

Cellular Component

adrenomedullin receptor complex (IEA,ISO)

amylin receptor complex 3 (IEA,ISO)

cell surface (IBA,IEA,ISO)

lysosome (IEA,ISO)

membrane (IEA)

plasma membrane (IEA,ISO,ISS)

receptor complex (IBA,IEA,ISO)

Molecular Function

adrenomedullin receptor activity (IEA,ISO)

amylin receptor activity (IEA,ISO)

coreceptor activity (IBA,IDA,IEA,ISO)

G protein-coupled receptor binding (NAS)

protein binding (ISO)

signaling receptor regulator activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Calcitonin and calcitonin receptor-like receptors: common themes with family B GPCRs?	Barwell J, etal., Br J Pharmacol. 2012 May;166(1):51-65. doi: 10.1111/j.1476-5381.2011.01525.x.
2.	Increased myocardial expression of RAMP1 and RAMP3 in rats with chronic heart failure.	Cueille C, etal., Biochem Biophys Res Commun 2002 Jun 7;294(2):340-6.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Adrenomedullin production is increased in colorectal adenocarcinomas; its relation to matrix metalloproteinase-9.	Hikosaka T, etal., Peptides. 2011 Sep;32(9):1825-31. doi: 10.1016/j.peptides.2011.07.012. Epub 2011 Aug 3.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Rat receptor-activity-modifying proteins (RAMPs) for adrenomedullin/CGRP receptor: cloning and upregulation in obstructive nephropathy.	Nagae T, etal., Biochem Biophys Res Commun 2000 Apr 2;270(1):89-93.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Novel regulation of adrenomedullin receptor by PDGF: role of receptor activity modifying protein-3.	Nowak W, etal., Am J Physiol Cell Physiol 2002 Jun;282(6):C1322-31.
10.	Cloning, characterization and central nervous system distribution of receptor activity modifying proteins in the rat.	Oliver KR, etal., Eur J Neurosci 2001 Aug;14(4):618-28.
11.	mRNA expression of novel CGRP1 receptors and their activity-modifying proteins in hypoxic rat lung.	Qing X, etal., Am J Physiol Lung Cell Mol Physiol 2001 Mar;280(3):L547-54.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Cardiac fibroblasts are major production and target cells of adrenomedullin in the heart in vitro.	Tomoda Y, etal., Cardiovasc Res 2001 Mar;49(4):721-30.
16.	Adrenomedullin and its receptor complexes in remnant kidneys of rats with renal mass ablation: decreased expression of calcitonin receptor-like receptor and receptor-activity modifying protein-3.	Totsune K, etal., Peptides 2001 Nov;22(11):1933-7.
17.	Alterations of intrarenal adrenomedullin and its receptor system in heart failure rats.	Yoshihara F, etal., Hypertension 2001 Feb;37(2):216-22.

Additional References at PubMed

PMID:1299115	PMID:9620797	PMID:10854696	PMID:10882736	PMID:11804624	PMID:12538603	PMID:12801991	PMID:14715154	PMID:14722252	PMID:15613468	PMID:15623431	PMID:15680493
PMID:16040721	PMID:16376586	PMID:16713642	PMID:18434369	PMID:21034462	PMID:22500019	PMID:23674134	PMID:26927337

Genomics

Comparative Map Data

Ramp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	85,741,314 - 85,758,813 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	85,755,211 - 85,758,818 (+)	Ensembl				GRCr8
mRatBN7.2	14	81,527,404 - 81,544,905 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	81,527,385 - 81,544,902 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	85,928,688 - 85,946,185 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	87,168,498 - 87,186,001 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	83,618,093 - 83,635,590 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	86,922,223 - 86,939,722 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	86,922,223 - 86,939,719 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	80,555,482 - 80,572,981 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	87,417,290 - 87,434,789 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	80,409,008 - 80,426,508 (+)	NCBI		Celera
RGSC_v3.1	14	87,436,434 - 87,453,933 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

RAMP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	45,157,791 - 45,184,250 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	45,157,648 - 45,188,665 (+)	Ensembl			hg38	GRCh38
GRCh37	7	45,197,390 - 45,223,849 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	45,163,892 - 45,190,374 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	44,970,638 - 44,997,087	NCBI
Celera	7	45,296,201 - 45,322,683 (+)	NCBI		Celera
Cytogenetic Map	7	p13	NCBI
HuRef	7	45,081,154 - 45,107,455 (+)	NCBI		HuRef
CHM1_1	7	45,201,027 - 45,227,508 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	45,318,568 - 45,345,028 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	45,236,530 - 45,263,012 (+)	NCBI

Ramp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	6,608,507 - 6,627,478 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	6,608,521 - 6,627,475 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	6,658,506 - 6,677,478 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	6,658,521 - 6,677,475 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	6,558,536 - 6,577,478 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	6,558,536 - 6,577,478 (+)	NCBI		MGSCv36	mm8
Celera	11	18,979,836 - 18,982,575 (-)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	4.61	NCBI

Ramp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	7,159,845 - 7,168,792 (-)	Ensembl
ChiLan1.0	NW_004955456	7,159,845 - 7,168,718 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAMP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	50,070,783 - 50,097,555 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	98,395,524 - 98,422,292 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	45,871,687 - 45,898,159 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	45,937,607 - 45,964,088 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	45,937,607 - 45,966,041 (+)	Ensembl			panPan2	panpan1.1

RAMP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	16	2,664,601 - 2,679,402 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	14,181,470 - 14,196,274 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	14,181,436 - 14,196,296 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	16	13,814,391 - 13,829,193 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	13,793,847 - 13,808,648 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ramp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	100,765,846 - 100,789,731 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	19,977,539 - 20,004,838 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	19,977,618 - 20,001,366 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAMP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	50,319,797 - 50,366,739 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	50,319,795 - 50,366,757 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	55,155,083 - 55,174,055 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAMP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	13,494,981 - 13,521,141 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666062	9,009,778 - 9,035,756 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ramp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	7,241,296 - 7,249,410 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	7,240,841 - 7,249,313 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ramp3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	75,590,119 - 75,607,698 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ramp3
164 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	642
Count of miRNA genes:	292
Interacting mature miRNAs:	353
Transcripts:	ENSRNOT00000010866
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
631213	Bw60	Body weight QTL60	4.51		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	84164970	100078267	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	65	156	90	89	58	92	58	6	352	189	11	134	81	92	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_020100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB028935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB030944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB042889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF181552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086468 ⟹ ENSRNOP00000074204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	81,527,385 - 81,544,902 (+)	Ensembl
Rnor_6.0 Ensembl	14	86,922,223 - 86,939,719 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094133 ⟹ ENSRNOP00000093875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	85,755,211 - 85,758,818 (+)	Ensembl
mRatBN7.2 Ensembl	14	81,541,303 - 81,544,902 (+)	Ensembl

RefSeq Acc Id:

NM_020100 ⟹ NP_064485

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	85,741,314 - 85,758,813 (+)	NCBI
mRatBN7.2	14	81,527,404 - 81,544,905 (+)	NCBI
Rnor_6.0	14	86,922,223 - 86,939,722 (+)	NCBI
Rnor_5.0	14	80,555,482 - 80,572,981 (+)	NCBI
RGSC_v3.4	14	87,417,290 - 87,434,789 (+)	RGD
Celera	14	80,409,008 - 80,426,508 (+)	RGD

Sequence:

show sequence

GTTGCTGTAAGCCGAGTGCATCTTAGCTGGCCATGGCGACCCCGGCACAGCGGCTGCACCTTCT
CCCTCTGTTGCTGCTGCTTTGTGGTGAGTGTGCCCAAGTATGCGGTTGCAATGAGACAGGAATG
CTGGAGAGGTTGCCTCGCTGTGGGAAAGCCTTTGCCGAAATGATGCAGAAGGTGGACGTCTGGA
AGTGGTGCAACCTGTCGGAGTTCATCGTGTACTACGAAAGCTTCACTAACTGCACGGAGATGGA
GACAAACATCGTGGGCTGCTACTGGCCCAACCCGCTGGCCCAGAGCTTTATCACGGGTATCCAT
AGGCAGTTCTTTTCCAACTGCACTGTGGACAGGACCCACTGGGAAGACCCCCCGGATGAAGTTC
TCATCCCACTTATCGCAGTTCCAGTCTTGTTGACCGTGGCTATGGCTGGGCTGGTGGTATGGCG
TAGCAAGCGCACTGACCGGCTTCTGTGAGGGCCTGCGGGATGGAAGGCCGTGCCTGGCAAGCTA
GAAGAATGTCGCCCAGAGCTCTGAGAGCCTGCAGACTCTGTTTCTGTCTGGTCTGCCTTGGCCA
CACCCTACCTGGTCGTGTCAAAGTCCTCCTGACTAGACTGACGTGGCCCTTGCTGTCTAGCCTG
CTGCCTGGTGGGGTTCAGGCTGCCCCGACAGGTGCTTCACTCTTTCTTGGGCTAGTGGAAGAAA
GTGACAAACCTCACATTTGTGTACCAGGCGTGGAAATCATCTCTTGCTGAGTCCCACCCTCCCT
GGGCTGAATTCCCGAGTCTCTAGACATTTCTTGGCAGAGTCTGGCCCAGCCTCAACCCTAACCC
AGGTCCTGACCCATTTCTATCCCTGACCCTGACCTCTGCTACGCTTGGGGCAGAGAGGGCAGGC
AAGGTCATCTGGAAGGTGTGGCGTCCCGAGCAGAAAGAGAGATGAGCACATTCTCTGTTGGACA
TGAAGAGTAGTCGGGGGGATTGGGGAATGGAGTTGTTAGGAGTCATGTGTGACCTACGGACCTG
CCTGTCTTCTAGGCGATCTGCCATGATTCTGTGTCCAGTGTGGGCTGGAGCTGTGATTTGTTTA
ACCCTTCAGATCCCTACCCTGAAGATAGAGAGTGAACCTCCTTCCTGAGGGGTATTCCTGGGGG
TGAGGCACGCTCTGAGCGTGCTCAAGGGTTCTGTCTGCTGATGTCTGCTTTCTGATTAAAGTGT
CTCCTTACAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063273515 ⟹ XP_063129585

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	85,746,698 - 85,758,813 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_064485	(Get FASTA)	NCBI Sequence Viewer
	XP_063129585	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG09436	(Get FASTA)	NCBI Sequence Viewer
	BAA79196	(Get FASTA)	NCBI Sequence Viewer
	BAA94427	(Get FASTA)	NCBI Sequence Viewer
	BAB03506	(Get FASTA)	NCBI Sequence Viewer
	EDM00374	(Get FASTA)	NCBI Sequence Viewer
	EDM00375	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074204.1
GenBank Protein	Q9JJ73	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_064485 ⟸ NM_020100
- Peptide Label:	precursor
- UniProtKB:	Q9JJ73 (UniProtKB/Swiss-Prot), A6IKW0 (UniProtKB/TrEMBL), Q9JMD8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFAEMMQKVDVWKWCNLSEFIVY YESFTNCTEMETNIVGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVLL TVAMAGLVVWRSKRTDRLL hide sequence

Ensembl Acc Id:

ENSRNOP00000074204 ⟸ ENSRNOT00000086468

Ensembl Acc Id:

ENSRNOP00000093875 ⟸ ENSRNOT00000094133

RefSeq Acc Id:	XP_063129585 ⟸ XM_063273515
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AKX1 (UniProtKB/TrEMBL), A6IKW1 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJ73-F1-model_v2	AlphaFold	Q9JJ73	1-147	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699482

Promoter ID:

EPDNEW_R10005

Type:

initiation region

Name:

Ramp3_1

Description:

receptor activity modifying protein 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	86,922,244 - 86,922,304	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61873	AgrOrtholog
BioCyc Gene	G2FUF-15064	BioCyc
Ensembl Genes	ENSRNOG00000053766	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000086468.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.150.510	UniProtKB/Swiss-Prot
InterPro	RAMP	UniProtKB/Swiss-Prot
	RAMP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:56820	UniProtKB/Swiss-Prot
NCBI Gene	56820	ENTREZGENE
PANTHER	PTHR14076	UniProtKB/Swiss-Prot
	RECEPTOR ACTIVITY-MODIFYING PROTEIN 3	UniProtKB/Swiss-Prot
Pfam	RAMP	UniProtKB/Swiss-Prot
PhenoGen	Ramp3	PhenoGen
RatGTEx	ENSRNOG00000053766	RatGTEx
UniProt	A0A8I6AKX1	ENTREZGENE, UniProtKB/TrEMBL
	A6IKW0	ENTREZGENE, UniProtKB/TrEMBL
	A6IKW1	ENTREZGENE, UniProtKB/TrEMBL
	Q9JJ73	ENTREZGENE
	Q9JMD8	ENTREZGENE, UniProtKB/TrEMBL
	Q9WVQ2_RAT	UniProtKB/TrEMBL
	RAMP3_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-23	Ramp3	receptor activity modifying protein 3	Ramp3	receptor (G protein-coupled) activity modifying protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Ramp3	receptor (G protein-coupled) activity modifying protein 3	Ramp3	receptor (calcitonin) activity modifying protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ramp3	receptor (calcitonin) activity modifying protein 3			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may play a role in chronic heart failure	625420
gene_expression	expressed in renal cortex and medulla	68718
gene_expression	mRNA and protein is expressed in both atria and ventricles with a 10 fold increase in expression observed in chronic heart failure models	625420
gene_expression	expressed in quiescent mesangial cells	631307
gene_function	transports calcitonin receptor-like receptor (Calcr) to the cell membrane and determines its glycosylation state	61729
gene_function	transports calcitonin receptor-like receptor (Calcr) to the cell membrane and determines its glycosylation state	68718
gene_function	transports calcitonin receptor-like receptor (Calcr) to the cell membrane and determines its glycosylation state	68902
gene_physical_interaction	forms a complex with calcitonin receptor-like receptor (CRLR) which responds to adrenomedullin (ADM) and to a lesser extend to calcitonin gene-related peptide (CGRP)	625420
gene_process	involved in potentiating adrenomedullin-mediated adenylate cyclase activity and inhibition of DNA synthesis	631307
gene_regulation	expression and mRNA stability is increased by Pdgfb in a concentration-dependent manner	631307
gene_regulation	mRNA expression is increased by Mek1	631307

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message