Advanced Search (OLGA)

Gene: Htr3b (5-hydroxytryptamine receptor 3B) Rattus norvegicus

Analyze

Symbol:

Htr3b

Name:

5-hydroxytryptamine receptor 3B

RGD ID:

61820

Description:

Enables serotonin-gated monoatomic cation channel activity. Involved in cellular response to growth factor stimulus. Located in axon and neuronal cell body. Human ortholog(s) of this gene implicated in alcohol use disorder and depressive disorder. Orthologous to human HTR3B (5-hydroxytryptamine receptor 3B); INTERACTS WITH ammonium chloride; capsaicin; chlorpyrifos.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

5-HT-3B; 5-HT3-B; 5-HT3B; 5-hydroxytryptamine (serotonin) receptor 3b; 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic; serotonin receptor 3B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HTR3B (5-hydroxytryptamine receptor 3B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Htr3b (5-hydroxytryptamine (serotonin) receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Htr3b (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HTR3B (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HTR3B (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Htr3b (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HTR3B (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HTR3B (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Htr3b (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Htr3b (5-hydroxytryptamine receptor 3B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR5AN1 (olfactory receptor family 5 subfamily AN member 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Htr3b (5-hydroxytryptamine (serotonin) receptor 3B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HTR3B (5-hydroxytryptamine receptor 3B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	htr3b (5-hydroxytryptamine (serotonin) receptor 3B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	LOC103909974 (5-hydroxytryptamine receptor 3A-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lgc-13	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-18	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lgc-19	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	htr3b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	58,175,785 - 58,204,939 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	58,175,101 - 58,204,939 (-)	Ensembl				GRCr8
mRatBN7.2	8	49,279,291 - 49,308,444 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	49,279,173 - 49,308,444 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	54,785,135 - 54,814,297 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	53,064,003 - 53,093,165 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	50,928,257 - 50,957,416 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	53,247,881 - 53,278,170 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	53,248,705 - 53,277,859 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	51,862,661 - 51,892,260 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	52,198,432 - 52,228,238 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	48,836,808 - 48,865,974 (-)	NCBI		Celera
RGSC_v3.1	8	52,217,485 - 52,247,292 (-)	NCBI
Cytogenetic Map	8	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol use disorder (ISO)

Cocaine-Related Disorders (ISO)

depressive disorder (ISO)

muscular disease (ISO)

Pain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

capsaicin (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

Cuprizon (EXP)

diazinon (EXP)

dieldrin (EXP)

dopamine (ISO)

ethanol (ISO)

fulvestrant (ISO)

methoxychlor (EXP)

nickel atom (EXP)

nitrates (EXP)

okadaic acid (ISO)

propan-1-ol (ISO)

serotonin (ISO)

tetrachloromethane (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to growth factor stimulus (IEP)

chemical synaptic transmission (IBA)

excitatory postsynaptic potential (IEA)

monoatomic ion transmembrane transport (IBA,IEA)

monoatomic ion transport (IEA)

positive regulation of ion transmembrane transporter activity (IDA)

regulation of membrane potential (IBA)

regulation of postsynaptic membrane potential (IEA)

serotonin receptor signaling pathway (IEA,ISO)

serotonin-gated cation-selective signaling pathway (IEA,ISO)

Cellular Component

axon (IDA)

cell surface (IEA,ISO)

membrane (IEA)

neuron projection (IBA)

neuronal cell body (IDA)

plasma membrane (IBA,IEA,ISO)

postsynaptic membrane (IEA)

serotonin-activated cation-selective channel complex (IEA,ISO)

synapse (IBA)

transmembrane transporter complex (IBA)

Molecular Function

excitatory extracellular ligand-gated monoatomic ion channel activity (IBA)

extracellular ligand-gated monoatomic ion channel activity (IEA)

ligand-gated monoatomic ion channel activity (IEA)

monoatomic ion channel activity (IEA)

serotonin-gated monoatomic cation channel activity (IBA,IDA,IEA,ISO)

transmembrane signaling receptor activity (IEA)

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Immunolabelling of the 5-HT 3B receptor subunit in the central and peripheral nervous systems in rodents.	Doucet E, etal., Eur J Neurosci. 2007 Jul;26(2):355-66.
2.	Functional genetic variants that increase synaptic serotonin and 5-HT3 receptor sensitivity predict alcohol and drug dependence.	Enoch MA, etal., Mol Psychiatry. 2011 Nov;16(11):1139-46. doi: 10.1038/mp.2010.94. Epub 2010 Sep 14.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Evidence for expression of heteromeric serotonin 5-HT(3) receptors in rodents.	Hanna MC, etal., J Neurochem 2000 Jul;75(1):240-7.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Differential composition of 5-hydroxytryptamine3 receptors synthesized in the rat CNS and peripheral nervous system.	Morales M and Wang SD, J Neurosci 2002 Aug 1;22(15):6732-41.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Distinguishable haplotype blocks in the HTR3A and HTR3B region in the Japanese reveal evidence of association of HTR3B with female major depression.	Yamada K, etal., Biol Psychiatry. 2006 Jul 15;60(2):192-201. Epub 2006 Feb 17.

Additional References at PubMed

PMID:9950429	PMID:16571125	PMID:21849148

Genomics

Comparative Map Data

Htr3b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	58,175,785 - 58,204,939 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	58,175,101 - 58,204,939 (-)	Ensembl				GRCr8
mRatBN7.2	8	49,279,291 - 49,308,444 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	49,279,173 - 49,308,444 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	54,785,135 - 54,814,297 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	53,064,003 - 53,093,165 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	50,928,257 - 50,957,416 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	53,247,881 - 53,278,170 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	53,248,705 - 53,277,859 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	51,862,661 - 51,892,260 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	52,198,432 - 52,228,238 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	48,836,808 - 48,865,974 (-)	NCBI		Celera
RGSC_v3.1	8	52,217,485 - 52,247,292 (-)	NCBI
Cytogenetic Map	8	q23	NCBI

HTR3B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	113,898,923 - 113,949,079 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	113,904,796 - 113,949,079 (+)	Ensembl			hg38	GRCh38
GRCh37	11	113,775,518 - 113,819,801 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	113,280,799 - 113,322,493 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	113,280,798 - 113,322,492	NCBI
Celera	11	110,928,462 - 110,970,153 (+)	NCBI		Celera
Cytogenetic Map	11	q23.2	NCBI
HuRef	11	109,703,741 - 109,746,039 (+)	NCBI		HuRef
CHM1_1	11	113,659,109 - 113,701,462 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	113,909,263 - 113,959,423 (+)	NCBI		T2T-CHM13v2.0

Htr3b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	48,846,308 - 48,876,290 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	48,846,308 - 48,876,290 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	48,935,008 - 48,964,990 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	48,935,008 - 48,964,990 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	48,743,113 - 48,773,095 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	48,686,940 - 48,716,922 (-)	NCBI		MGSCv36	mm8
Celera	9	46,232,548 - 46,262,426 (-)	NCBI		Celera
Cytogenetic Map	9	A5.3	NCBI
cM Map	9	26.54	NCBI

Htr3b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	15,524,854 - 15,569,638 (+)	Ensembl
ChiLan1.0	NW_004955412	15,524,854 - 15,569,638 (+)	NCBI	ChiLan1.0	ChiLan1.0

HTR3B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	114,651,706 - 114,693,516 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	115,746,061 - 115,787,844 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	108,783,514 - 108,825,266 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	112,624,935 - 112,667,552 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	112,624,864 - 112,671,439 (+)	Ensembl			panPan2	panpan1.1

HTR3B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	19,361,011 - 19,393,206 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	19,362,382 - 19,414,912 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	19,285,803 - 19,320,666 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	19,382,880 - 19,437,139 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	19,378,789 - 19,435,866 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	19,446,834 - 19,500,873 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	19,348,309 - 19,402,388 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	19,395,281 - 19,449,681 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Htr3b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	95,997,676 - 96,074,157 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936612	677,910 - 707,870 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936612	631,995 - 712,037 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HTR3B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	41,512,374 - 41,556,738 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	41,512,467 - 41,556,912 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	46,329,503 - 46,371,073 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HTR3B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	105,287,738 - 105,328,793 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	105,288,865 - 105,328,714 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	20,694,212 - 20,734,265 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Htr3b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	9,388,285 - 9,446,572 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624784	9,387,712 - 9,446,493 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Htr3b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	43,426,717 - 43,456,607 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Htr3b
132 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	26
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000009574
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
5684993	Bmd84	Bone mineral density QTL 84	4.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	8	51589699	58991895	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	37760859	58991895	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	49610204	68373388	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	50763951	67219641	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat

Markers in Region

RH133711

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	49,278,618 - 49,278,801 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	53,248,033 - 53,248,215	NCBI	Rnor6.0
Rnor_5.0	8	51,862,206 - 51,862,388	UniSTS	Rnor5.0
RGSC_v3.4	8	52,197,760 - 52,197,942	UniSTS	RGSC3.4
Celera	8	48,836,136 - 48,836,318	UniSTS
RH 3.4 Map	8	524.0	UniSTS
Cytogenetic Map	8	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	32	17	10	1	29	11	24	9	36	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595876	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF155044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF303447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009574 ⟹ ENSRNOP00000009574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	58,175,101 - 58,204,939 (-)	Ensembl
mRatBN7.2 Ensembl	8	49,279,173 - 49,308,444 (-)	Ensembl
Rnor_6.0 Ensembl	8	53,248,705 - 53,277,859 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105266 ⟹ ENSRNOP00000083913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	58,175,101 - 58,198,992 (-)	Ensembl
mRatBN7.2 Ensembl	8	49,279,173 - 49,302,497 (-)	Ensembl

RefSeq Acc Id:

NM_022189 ⟹ NP_071525

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	58,175,785 - 58,204,939 (-)	NCBI
mRatBN7.2	8	49,279,291 - 49,308,444 (-)	NCBI
Rnor_6.0	8	53,248,705 - 53,277,859 (-)	NCBI
Rnor_5.0	8	51,862,661 - 51,892,260 (-)	NCBI
RGSC_v3.4	8	52,198,432 - 52,228,238 (-)	RGD
Celera	8	48,836,808 - 48,865,974 (-)	RGD

Sequence:

show sequence

TGGTACCTGCCCCAGAACAATAGGCAAGTGCGATGATTCTTCTGTGGTCCTGCCTCCTGGTGGC
TGTCGTAGGTATTCTAGGCACAGCGACACCTCAGCCTGGGAATTCCTCTCTGCATCGCCTCACC
AGGCAGCTGCTACAGCAGTACCACAAGGAGGTCAGACCAGTTTACAACTGGGCTGAGGCCACCA
CTGTCTACCTGGACCTTTGCGTCCATGCTGTATTGGATGTGGATGTACAGAATCAAAAATTAAA
GACAAGCATGTGGTACCGAGAGGTTTGGAATGATGAGTTTCTGTCCTGGAACTCTAGTCTGTTC
GATGATATTCAAGAGATCTCTCTCCCTCTCAGTGCCATCTGGGCCCCTGATATCATCATTAATG
AGTTTGTGGATGTCGAAAGGTCTCCTGACCTGCCCTATGTATACGTGAACTCTTCCGGAACGAT
TAGAAACCACAAGCCCATCCAGGTGGTCTCCGCATGCAGTTTGCAGACATACGCTTTCCCCTTT
GATATCCAGAACTGCAGTCTCACCTTCAATAGCATCCTGCATACAGTGGAAGACATAGACCTGG
GCTTCCTGAGGAACCAAGAAGACATTGAGAACGACAAAAGGTCTTTTCTGAATGACAGCGAGTG
GCAGCTTCTTTCTGTGACCTCCACTTACCACATCCGGCAGAGCAGCGCTGGTGACTTCGCACAG
ATTCGGTTTAATGTAGTGATTCGCAGATGTCCATTGGCCTATGTTGTGAGCCTCTTGATTCCTA
GCATCTTCCTGATGCTCGTGGACCTGGGAAGCTTCTACTTGCCCCCCAACTGTCGTGCCAGAAT
TGTGTTCAAGACCAATGTGCTGGTGGGCTATACAGTCTTCAGGGTCAACATGTCTGATGAGGTG
CCAAGAAGCGCAGGGTGCACATCTCTGATTGGGGTCTTCTTTACCGTCTGCATGGCCCTCTTGG
TTCTCAGTTTATCCAAATCCATCTTGTTGATCAAATTCCTCTATGAGGAGCGGCACAGTGAGCA
AGAACGGCCTCTTATGTGCCTTCGAGGGGACTCTGATGCCAATGAGTCTAGATTGTACCTCAGA
GCTCCATGTGCTGAGGACACAGAGTCCCCGGTTCGTCAGGAGCACCAGGTCCCATCAGATACTC
TGAAGGATTTCTGGTTCCAGCTCCAATCCATCAACAACTCTCTCCGAACTCGGGATCAGGTTTA
CCAGAAGGAGGTGGAGTGGCTCGCCATCCTGTGCCACTTTGATCAGCTGCTCTTCCGAATCTAC
CTTGCCGTGCTGGGGCTCTATACTGTCACCTTATGCTCTCTCTGGGCACTGTGGAGCAGGATGT
GA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071525	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF73283	(Get FASTA)	NCBI Sequence Viewer
	AAG30903	(Get FASTA)	NCBI Sequence Viewer
	EDL95431	(Get FASTA)	NCBI Sequence Viewer
	EDL95432	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009574
GenBank Protein	Q9JJ16	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071525 ⟸ NM_022189
- Peptide Label:	precursor
- UniProtKB:	Q9ERJ5 (UniProtKB/Swiss-Prot), Q9JJ16 (UniProtKB/Swiss-Prot), A6J4A8 (UniProtKB/TrEMBL), G3V6W4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MILLWSCLLVAVVGILGTATPQPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAV LDVDVQNQKLKTSMWYREVWNDEFLSWNSSLFDDIQEISLPLSAIWAPDIIINEFVDVERSPDL PYVYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDIDLGFLRNQEDIEN DKRSFLNDSEWQLLSVTSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGS FYLPPNCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTSLIGVFFTVCMALLVLSLSKSILLI KFLYEERHSEQERPLMCLRGDSDANESRLYLRAPCAEDTESPVRQEHQVPSDTLKDFWFQLQSI NNSLRTRDQVYQKEVEWLAILCHFDQLLFRIYLAVLGLYTVTLCSLWALWSRM hide sequence

Ensembl Acc Id:

ENSRNOP00000009574 ⟸ ENSRNOT00000009574

Ensembl Acc Id:

ENSRNOP00000083913 ⟸ ENSRNOT00000105266

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJ16-F1-model_v2	AlphaFold	Q9JJ16	1-437	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61820	AgrOrtholog
BioCyc Gene	G2FUF-30591	BioCyc
Ensembl Genes	ENSRNOG00000006920	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000009574	ENTREZGENE
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	5HT3_rcpt	UniProtKB/Swiss-Prot
	5HT3_rcpt_B	UniProtKB/Swiss-Prot
	LGIC_TM_5-HT3	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
KEGG Report	rno:58963	UniProtKB/Swiss-Prot
NCBI Gene	58963	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PharmGKB	HTR3B	RGD
PhenoGen	Htr3b	PhenoGen
PRINTS	5HT3BRECEPTR	UniProtKB/Swiss-Prot
	5HT3RECEPTOR	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006920	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
UniProt	5HT3B_RAT	UniProtKB/Swiss-Prot
	A0A8I6A087_RAT	UniProtKB/TrEMBL
	A6J4A8	ENTREZGENE, UniProtKB/TrEMBL
	A6J4A9_RAT	UniProtKB/TrEMBL
	G3V6W4	ENTREZGENE, UniProtKB/TrEMBL
	Q9ERJ5	ENTREZGENE
	Q9JJ16	ENTREZGENE
UniProt Secondary	Q9ERJ5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Htr3b	5-hydroxytryptamine receptor 3B	Htr3b	5-hydroxytryptamine (serotonin) receptor 3B, ionotropic	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-17	Htr3b	5-hydroxytryptamine (serotonin) receptor 3B, ionotropic	Htr3b	5-hydroxytryptamine (serotonin) receptor 3b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Htr3b	5-hydroxytryptamine (serotonin) receptor 3b			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression is restricted to peripheral neurons	625727
gene_other	expression of recombinant 5-HT3B subunit alone does not produce a functional 5-HT3 receptor	625727
gene_process	forms heteromeric receptor complexes with Htr3a which have large single-channel conductance, low permeability to calcium ions and a linear current-voltage relationship	625727
gene_protein	expression of recombinant 5-HT3B subunit alone does not produce a functional 5-HT3 receptor
gene_regulation	expression is induced by nerve growth factor

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD