Advanced Search (OLGA)

Gene: Syt2 (synaptotagmin 2) Rattus norvegicus

Analyze

Symbol:

Syt2

Name:

synaptotagmin 2

RGD ID:

3804

Description:

Enables calcium-dependent phospholipid binding activity and syntaxin binding activity. Predicted to be involved in positive regulation of dendrite extension and regulation of vesicle-mediated transport. Located in terminal bouton. Is active in synaptic vesicle membrane. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome and congenital myasthenic syndrome 7. Orthologous to human SYT2 (synaptotagmin 2); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

RATSYNII; synaptotagmin II; synaptotagmin-2; SYNII; sytII

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYT2 (synaptotagmin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Syt2 (synaptotagmin II)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Syt2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYT2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYT2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Syt2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYT2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYT2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Syt2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Syt2 (synaptotagmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SYT1 (synaptotagmin 1)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Syt2 (synaptotagmin II)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SYT2 (synaptotagmin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syt2a (synaptotagmin IIa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syt2a (synaptotagmin IIa)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Syt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Syt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snt-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snt-2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	snt-3	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	snt-3	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)

Is Marker For:

Strains: SS.SR-(Syt2-D13Mit1)/Jr
QTLs: Thym2 Bp159

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	48,639,634 - 48,749,814 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	48,639,934 - 48,749,812 (+)	Ensembl				GRCr8
mRatBN7.2	13	46,088,046 - 46,197,976 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	46,185,282 - 46,193,859 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	48,791,632 - 48,800,091 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	50,079,700 - 50,088,159 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	47,345,602 - 47,354,226 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	51,569,248 - 51,577,824 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	51,534,025 - 51,578,052 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	56,621,954 - 56,630,530 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	47,690,518 - 47,699,094 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	46,512,022 - 46,520,623 (+)	NCBI		Celera
RGSC_v3.1	13	47,704,560 - 47,713,137 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

axonal neuropathy (ISO)

congenital myasthenic syndrome (ISO)

congenital myasthenic syndrome 7 (ISO)

Contracture (ISO)

genetic disease (ISO)

Muscle Weakness (ISO)

Presynaptic Congenital Myasthenic Syndrome 7B, Autosomal Recessive (ISO)

spinal muscular atrophy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloroethane (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

bromobenzene (EXP)

butanal (ISO)

CGP 52608 (ISO)

cisplatin (EXP)

clozapine (ISO)

cocaine (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

Cuprizon (EXP)

Dibutyl phosphate (ISO)

dichlorine (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

folic acid (ISO)

fonofos (ISO)

furan (EXP)

genistein (EXP)

lead diacetate (EXP)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methotrexate (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (ISO)

N-methyl-4-phenylpyridinium (ISO)

okadaic acid (ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

parathion (ISO)

PCB138 (ISO)

phencyclidine (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

terbufos (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (ISO)

trichloroethene (EXP)

trichostatin A (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-dependent activation of synaptic vesicle fusion (IBA,ISO)

cell differentiation (IEA)

positive regulation of dendrite extension (IEA,ISO)

regulated exocytosis (IEA)

regulation of calcium ion-dependent exocytosis (IBA)

regulation of synaptic vesicle exocytosis (IBA)

synaptic vesicle exocytosis (TAS)

vesicle-mediated transport (IBA)

Cellular Component

axon (IBA,ISO)

chromaffin granule membrane (IEA)

cytoplasm (IEA)

cytoplasmic vesicle (IEA)

dense core granule (IBA)

exocytic vesicle (IBA)

membrane (IEA)

neuromuscular junction (ISO)

plasma membrane (IBA,ISO)

synaptic vesicle membrane (IBA,IDA,IEA,IEP,TAS)

terminal bouton (HDA)

Molecular Function

calcium ion binding (IEA,ISO,TAS)

calcium ion sensor activity (IBA)

calcium-dependent phospholipid binding (IBA,IDA,IEA,ISO)

inositol 1,3,4,5 tetrakisphosphate binding (ISO,ISS)

metal ion binding (IEA)

phosphatidylserine binding (ISO)

protein binding (IPI,ISO)

SNARE binding (IBA)

syntaxin binding (IDA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

albuminuria (IAGP)

salt-sensitive hypertension (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II.	Berntsson RP, etal., Structure. 2013 Sep 3;21(9):1602-11. doi: 10.1016/j.str.2013.06.026. Epub 2013 Aug 8.
2.	Direct interaction of the calcium sensor protein synaptotagmin I with a cytoplasmic domain of the alpha1A subunit of the P/Q-type calcium channel.	Charvin N, etal., EMBO J. 1997 Aug 1;16(15):4591-6.
3.	Congenic mapping and sequence analysis of the Renin locus.	Flister MJ, etal., Hypertension. 2013 Apr;61(4):850-6. doi: 10.1161/HYPERTENSIONAHA.111.01008. Epub 2013 Mar 4.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Synaptotagmin II. A novel differentially distributed form of synaptotagmin.	Geppert M, etal., J Biol Chem 1991 Jul 25;266(21):13548-52.
6.	Botulinum neurotoxin B recognizes its protein receptor with high affinity and specificity.	Jin R, etal., Nature. 2006 Dec 21;444(7122):1092-5. Epub 2006 Dec 13.
7.	WNK1 phosphorylates synaptotagmin 2 and modulates its membrane binding.	Lee BH, etal., Mol Cell. 2004 Sep 10;15(5):741-51.
8.	Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.	Li C, etal., Nature 1995 Jun 15;375(6532):594-9.
9.	The synaptic vesicle protein 2C mediates the uptake of botulinum neurotoxin A into phrenic nerves.	Mahrhold S, etal., FEBS Lett. 2006 Apr 3;580(8):2011-4. Epub 2006 Mar 7.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Calcium-dependent oligomerization of synaptotagmins I and II. Synaptotagmins I and II are localized on the same synaptic vesicle and heterodimerize in the presence of calcium.	Osborne SL, etal., J Biol Chem. 1999 Jan 1;274(1):59-66.
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Human synaptotagmin-II is not a high affinity receptor for botulinum neurotoxin B and G: increased therapeutic dosage and immunogenicity.	Strotmeier J, etal., FEBS Lett. 2012 Feb 17;586(4):310-3. doi: 10.1016/j.febslet.2011.12.037. Epub 2012 Jan 16.
17.	Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.	Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
18.	Synaptotagmin-2, and -1, linked to neurotransmission impairment and vulnerability in Spinal Muscular Atrophy.	Tejero R, etal., Hum Mol Genet. 2016 Aug 29. pii: ddw297.
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
21.	Interval mapping and congenic strains for a blood pressure QTL on rat chromosome 13.	Zhang QY, etal., Mamm Genome 1997 Sep;8(9):636-41

Additional References at PubMed

PMID:7961887	PMID:7993622	PMID:8626542	PMID:10715114	PMID:10737807	PMID:12118064	PMID:12860971	PMID:14504267	PMID:14709554	PMID:16116949	PMID:16212888	PMID:17192432
PMID:19709630	PMID:21456023	PMID:22871113	PMID:23172916	PMID:23999003	PMID:29476059	PMID:31431523	PMID:32357304

Genomics

Comparative Map Data

Syt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	48,639,634 - 48,749,814 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	48,639,934 - 48,749,812 (+)	Ensembl				GRCr8
mRatBN7.2	13	46,088,046 - 46,197,976 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	46,185,282 - 46,193,859 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	48,791,632 - 48,800,091 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	50,079,700 - 50,088,159 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	47,345,602 - 47,354,226 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	51,569,248 - 51,577,824 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	51,534,025 - 51,578,052 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	56,621,954 - 56,630,530 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	47,690,518 - 47,699,094 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	46,512,022 - 46,520,623 (+)	NCBI		Celera
RGSC_v3.1	13	47,704,560 - 47,713,137 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

SYT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	202,590,596 - 202,710,454 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	202,590,596 - 202,710,526 (-)	Ensembl			hg38	GRCh38
GRCh37	1	202,559,724 - 202,679,582 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	200,831,511 - 200,946,168 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	199,296,544 - 199,411,202	NCBI
Celera	1	175,686,865 - 175,807,438 (-)	NCBI		Celera
Cytogenetic Map	1	q32.1	NCBI
HuRef	1	173,725,569 - 173,845,371 (-)	NCBI		HuRef
CHM1_1	1	203,981,971 - 204,101,776 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	201,852,402 - 201,972,645 (-)	NCBI		T2T-CHM13v2.0

Syt2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	134,574,319 - 134,680,887 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	134,574,415 - 134,690,331 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	134,646,534 - 134,753,149 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	134,646,677 - 134,762,593 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	136,543,258 - 136,645,994 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	136,463,092 - 136,565,828 (+)	NCBI		MGSCv36	mm8
Celera	1	137,257,554 - 137,373,520 (+)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	58.24	NCBI

Syt2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	38,643,911 - 38,743,222 (-)	Ensembl
ChiLan1.0	NW_004955406	38,638,192 - 38,743,077 (-)	NCBI	ChiLan1.0	ChiLan1.0

SYT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	46,671,196 - 46,785,814 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	46,637,844 - 46,758,650 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	178,187,872 - 178,308,522 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	182,484,225 - 182,605,743 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	182,490,401 - 182,538,123 (-)	Ensembl			panPan2	panpan1.1

SYT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	497,387 - 509,338 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	497,394 - 502,952 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	478,659 - 557,321 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	433,590 - 512,581 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	433,409 - 512,622 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	422,285 - 501,206 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	531,125 - 609,898 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	554,413 - 633,358 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Syt2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	72,642,164 - 72,749,746 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936567	1,941,639 - 1,984,428 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936567	1,941,651 - 1,984,422 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	24,638,704 - 24,669,846 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	24,638,645 - 24,727,198 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	29,086,244 - 29,094,379 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SYT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	26,702,627 - 26,821,108 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	26,808,007 - 26,817,314 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	27,480,660 - 27,602,721 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Syt2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	8,160,431 - 8,196,916 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624807	8,103,665 - 8,201,567 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Syt2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	954,071 - 997,360 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Syt2
701 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	246
Count of miRNA genes:	163
Interacting mature miRNAs:	180
Transcripts:	ENSRNOT00000006637
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
6893344	Cm79	Cardiac mass QTL 79	1.5	0.04	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	46272922	51216694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
4145117	Mcs27	Mammary carcinoma susceptibility QTL 27		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	13	45990077	50392939	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
12879472	Bp399	Blood pressure QTL 399			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	47780418	50392939	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Markers in Region

D13Wox6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	13	56,629,542 - 56,629,737	NCBI	Rnor5.0
RGSC_v3.4	13	47,698,107 - 47,698,301	RGD	RGSC3.4
RGSC_v3.1	13	47,712,150 - 47,712,344	RGD
RH 3.4 Map	13	172.5	RGD
RH 2.0 Map	13	381.3	RGD

D13Arb8

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	48,744,711 - 48,744,906 (+)	Marker Load Pipeline
mRatBN7.2	13	46,192,872 - 46,193,066 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	51,576,838 - 51,577,031	NCBI	Rnor6.0
Rnor_5.0	13	56,629,544 - 56,629,737	UniSTS	Rnor5.0
RGSC_v3.4	13	47,698,108 - 47,698,301	UniSTS	RGSC3.4
Celera	13	46,519,637 - 46,519,830	UniSTS
RH 3.4 Map	13	172.5	UniSTS
SHRSP x BN Map	13	14.7798	RGD
SHRSP x BN Map	13	14.7798	UniSTS
Cytogenetic Map	13	q13	UniSTS

D13Mgh18

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	13	193.8	RGD
RH 3.4 Map	13	193.8	UniSTS
Cytogenetic Map	13	q13	UniSTS

D13Rjr1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	13	56,629,544 - 56,629,737	UniSTS	Rnor5.0
Celera	13	46,519,637 - 46,519,830	UniSTS
RGSC_v3.1	13	47,712,150 - 47,712,344	RGD
RH 3.4 Map	13	172.5	UniSTS
SHRSP x BN Map	13	14.7798	UniSTS
Cytogenetic Map	13	q13	UniSTS

D19Mgh6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	13	193.8	UniSTS
RH 2.0 Map	13	366.6	RGD

Related Rat Strains

The following Strains have been annotated to Syt2

SS.SR-(Syt2-D13Mit1)/Jr

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	8	39	158	73	72	41	77	41	6	276	147	11	137	72	90	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001429497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_012665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M64488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006637 ⟹ ENSRNOP00000006637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	48,639,934 - 48,749,812 (+)	Ensembl
mRatBN7.2 Ensembl	13	46,185,282 - 46,193,859 (+)	Ensembl
Rnor_6.0 Ensembl	13	51,534,025 - 51,578,052 (+)	Ensembl

RefSeq Acc Id:

NM_012665 ⟹ NP_036797

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,737,122 - 48,745,698 (+)	NCBI
mRatBN7.2	13	46,185,282 - 46,193,859 (+)	NCBI
Rnor_6.0	13	51,569,248 - 51,577,824 (+)	NCBI
Rnor_5.0	13	56,621,954 - 56,630,530 (+)	NCBI
RGSC_v3.4	13	47,690,518 - 47,699,094 (+)	RGD
Celera	13	46,512,022 - 46,520,623 (+)	RGD

Sequence:

show sequence

GGGAGCCGATCGGTGTGGGCTGGTGGAGAAGGCAGCGGGAGTCTGCCGCCCCGAAGTCCAGGTC
CCCTCTTCCCACTCCCGCGCCGGCCAGCGCTGCGGCTCCCCTCTGCCACCATGAGAAACATCTT
CAAGAGGAACCAGGAGCCCATTGTGGCTCCGGCCACCACCACTGCCACAATGCCTCTGGCACCC
GCCGCACCTGCCGATAACTCTACAGAGAGCACGGGCACCGGGGAGAGCCAAGAAGACATGTTCG
CCAAGCTGAAGGACAAATTCTTCAATGAGATCAACAAGATCCCTTTGCCCCCCTGGGCTCTGAT
TGCCATGGCCGTGGTTGCTGGCCTCCTGCTGCTCACCTGCTGCTTCTGCATCTGTAAGAAGTGC
TGCTGCAAGAAGAAGAAAAACAAGAAGGAGAAGGGCAAAGGCATGAAGAACGCCATGAACATGA
AGGACATGAAGGGGGGCCAGGATGATGACGACGCGGAGACAGGCCTGACTGAAGGAGAAGGAGA
AGGCGAGGAGGAGAAAGAGCCGGAGAACCTGGGCAAATTGCAGTTTTCTCTGGACTATGATTTC
CAAGCCAACCAGCTCACCGTGGGCGTCCTGCAGGCTGCTGAACTCCCGGCCCTGGACATGGGTG
GCACGTCAGACCCTTACGTCAAAGTCTTCCTCCTCCCAGACAAGAAGAAGAAATATGAGACCAA
GGTGCACCGGAAGACACTGAACCCAGCCTTCAACGAAACTTTCACTTTCAAGGTGCCATACCAG
GAGTTAGGAGGCAAAACCCTGGTGATGGCTATCTATGACTTTGACCGCTTCTCTAAGCATGACA
TCATCGGGGAGGTGAAAGTGCCCATGAACACGGTGGACCTTGGCCAGCCCATCGAGGAATGGAG
AGACCTACAAGGCGGAGAGAAGGAAGAGCCAGAGAAGCTGGGTGACATCTGTACCTCCTTGCGC
TACGTGCCCACTGCTGGGAAGCTCACCGTCTGTATCCTGGAGGCCAAGAACCTGAAGAAGATGG
ATGTGGGGGGCCTCTCAGACCCCTATGTGAAGATCCACTTGATGCAGAATGGCAAGAGACTCAA
GAAGAAGAAGACGACGGTGAAGAAGAAGACCTTGAACCCCTACTTCAATGAGTCATTCAGCTTC
GAGATCCCCTTTGAGCAGATCCAGAAAGTCCAGGTGGTCGTCACCGTGCTAGACTATGACAAAC
TGGGCAAGAATGAAGCCATCGGAAAGATCTTCGTAGGCAGCAACGCTACAGGCACGGAGCTGCG
GCACTGGTCCGACATGCTGGCGAACCCTCGGAGGCCCATCGCCCAGTGGCACTCTCTGAAGCCT
GAGGAAGAAGTGGATGCTCTTCTGGGCAAGAACAAGTAGGCAGCGGCGCCTGGGGCCACGCCCC
AGAGGACACTGACGAGCTCCAGAGCTATCAATACCTCAGTTATGCGACCTTAGAGGTTTCTTCA
TTTGTTTGCGGTGTGTCCTGTTTTCCTTTCCTTTTTCTTTTTTTGTCTTTTTAAAAACCAACTT
CCTTTTGGTGGCTATGTGAAGAGGCCCCTAAGACGTGAAAGAGAAGCCTGGCTCTGTTATTGTC
CCAGGAGCTGTCCTTGTTGCATGCCCTATCACGGTTGCCCCTCACCCCAAGTGGGGCCCTCTAC
TGTCAGAGTGGAAGCACTTCCTGCTTTTCCTGGGTTTTGGACCAACAAAGTGGCAAGCACATTC
TGTGTCTCGACTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGT
ACACGTGTGCCCATCCATCCCCACCTTGCCTCTGTTTGGAATATCTCTTCGTTTCTGGAATGAG
TCACGGACAATGATGCCGTGTGAGAGAGGAAAGTCTTCAGGTACTCCGAGGTGAGGAGAGCCCA
CTGCTTAAGTGGTCAGAGGCCAGAAGCTCTCATAGTCCTTGCGAAAGGCCATTTGGAAGACGCA
AGATGTGATACTGGATGTATTCCGAACTAGGACCAAAGGCTTGATGCCATCCCAGACTCCCTCT
TGTCAGTCATGGCTTCCCCAGGAGTGGGGCTTTGGGATCATTCATGAAAATAAACTATTTACTC
GACTGGTCGGATTCAGCCAGGGACCGCCAGCTCCAGGATGTCATTCTTGTTGACGACATCAAAC
TTTGAAGAAACAGAAGTCCCATTACTCAGCTCTGGATCTTTGCCTCGTCCAGTGGGAGGCAGAT
GCTTCCTCCCTCTGCAGAGTACAAGCAGTGCGTTCATTTGCATTCACGCACCATCTGCTTTTGC
CTCTGTTTCCCTTTTTGTGTAAGTGGAAAAATACCATCTGACGATAAGTGCTTTGCACAGAGCC
AGAGACCTATTAGAGGGATGCTTGGGTGTTTAGTTCCCTTGAGGTCCAGGTAAGGAGGAGGTGT
CAAGAAGGGGAGCGTTGGTGGACAGTGACAAGCTAGACATTGCAGAGCTCCTCACAACTCCTAT
TCCTGACCCTCTGGACCCTTTGACCCTCAGTGATGGTAGCCGGAGTAGCCCAGGCAGACCTTAG
GAGAGGCCCCGTCCTTCCCTTCCTTAGACAGTTTTCTCAGAATGCCAGGAAACACAGCGCATTC
ATTTCAGATGGGTGGTGGAGAAAATGTGCTAAGGTTTGCACCCTATGTTCGGAATTC

hide sequence

RefSeq Acc Id:

XM_039090348 ⟹ XP_038946276

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,702,823 - 48,749,814 (+)	NCBI
mRatBN7.2	13	46,151,004 - 46,197,976 (+)	NCBI

RefSeq Acc Id:

XM_039090349 ⟹ XP_038946277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,639,634 - 48,749,814 (+)	NCBI
mRatBN7.2	13	46,088,046 - 46,197,976 (+)	NCBI

RefSeq Acc Id:

XM_039090350 ⟹ XP_038946278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,703,866 - 48,749,814 (+)	NCBI
mRatBN7.2	13	46,152,068 - 46,197,976 (+)	NCBI

RefSeq Acc Id:

XM_063272035 ⟹ XP_063128105

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,703,275 - 48,749,814 (+)	NCBI

RefSeq Acc Id:

XM_063272036 ⟹ XP_063128106

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	48,739,356 - 48,749,814 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001416426	(Get FASTA)	NCBI Sequence Viewer
	NP_001416427	(Get FASTA)	NCBI Sequence Viewer
	NP_001416428	(Get FASTA)	NCBI Sequence Viewer
	NP_036797	(Get FASTA)	NCBI Sequence Viewer
	XP_038946276	(Get FASTA)	NCBI Sequence Viewer
	XP_038946277	(Get FASTA)	NCBI Sequence Viewer
	XP_038946278	(Get FASTA)	NCBI Sequence Viewer
	XP_063128105	(Get FASTA)	NCBI Sequence Viewer
	XP_063128106	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA63502	(Get FASTA)	NCBI Sequence Viewer
	EDM09719	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006637
GenBank Protein	P29101	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036797 ⟸ NM_012665

- UniProtKB:

G3V6M3 (UniProtKB/TrEMBL), A6ICC8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLP
PWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLT
EGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKK
KYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQP
IEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQN
GKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNAT
GTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

hide sequence

Ensembl Acc Id:

ENSRNOP00000006637 ⟸ ENSRNOT00000006637

RefSeq Acc Id:	XP_038946277 ⟸ XM_039090349
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038946276 ⟸ XM_039090348
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038946278 ⟸ XM_039090350
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063128105 ⟸ XM_063272035
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063128106 ⟸ XM_063272036
- Peptide Label:	isoform X2

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P29101-F1-model_v2	AlphaFold	P29101	1-422	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3804	AgrOrtholog
BIND	130562
BioCyc Gene	G2FUF-18224	BioCyc
Ensembl Genes	ENSRNOG00000004756	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000006637	ENTREZGENE
Gene3D-CATH	2.60.40.150	UniProtKB/Swiss-Prot
InterPro	C2_dom	UniProtKB/Swiss-Prot
	C2_domain_sf	UniProtKB/Swiss-Prot
	Synaptotagmin	UniProtKB/Swiss-Prot
KEGG Report	rno:24805	UniProtKB/Swiss-Prot
NCBI Gene	24805	ENTREZGENE
PANTHER	PTHR10024:SF223	UniProtKB/Swiss-Prot
	SYNAPTOTAGMIN	UniProtKB/Swiss-Prot
Pfam	PF00168	UniProtKB/Swiss-Prot
PhenoGen	Syt2	PhenoGen
PRINTS	C2DOMAIN	UniProtKB/Swiss-Prot
	SYNAPTOTAGMN	UniProtKB/Swiss-Prot
PROSITE	PS50004	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004756	RatGTEx
SMART	SM00239	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49562	UniProtKB/Swiss-Prot
TIGR	TC210189
UniProt	A6ICC8	ENTREZGENE, UniProtKB/TrEMBL
	G3V6M3	ENTREZGENE, UniProtKB/TrEMBL
	P29101	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-11	Syt2	synaptotagmin 2	Syt2	synaptotagmin II	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Syt2	synaptotagmin II		synaptotagmin 2	Name updated	1299863	APPROVED
2003-04-09	Syt2	synaptotagmin 2			Name updated	629478	APPROVED
2002-06-10	Syt2	synaptotagmin 2			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	binds acidic phospholipids, neurexins, syntaxin, and AP2	61047
gene_process	may have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse	61047
gene_product	member of a family of calcium sensors regulating neurotransmitter release	61047

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype