Symbol:
Scg5
Name:
secretogranin V
RGD ID:
3669
Description:
Predicted to enable enzyme inhibitor activity and unfolded protein binding activity. Predicted to be involved in intracellular protein transport; peptide hormone processing; and regulation of hormone secretion. Predicted to be located in secretory granule. Predicted to be active in nucleus. Orthologous to human SCG5 (secretogranin V); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
7B2; neuroendocrine protein 7B2; secretogranin V (7B2 protein); secretogranin-5; secretory granule endocrine protein I; secretory granule neuroendocrine protein 1; Secretory granule neuroendocrine protein 1 (7B2 protein); Secretory granule neuroendocrine, protein 1 (7B2 protein); Sgne1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SCG5 (secretogranin V) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Scg5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Scg5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SCG5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SCG5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Scg5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SCG5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SCG5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Scg5 (secretogranin V) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SCG5 (secretogranin V)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Scg5 (secretogranin V)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
scg5 (secretogranin V)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
7B2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
sbt-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
scg5
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 120,998,420 - 121,042,881 (-) NCBI GRCr8 mRatBN7.2 3 100,544,101 - 100,588,558 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 100,544,099 - 100,588,463 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 104,171,047 - 104,215,378 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 112,770,077 - 112,814,414 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 110,459,966 - 110,504,303 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 105,235,065 - 105,279,475 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 105,235,050 - 105,279,462 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 111,811,718 - 111,856,212 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 99,629,194 - 99,674,523 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 99,525,619 - 99,570,949 (-) NCBI Celera 3 99,515,552 - 99,558,902 (-) NCBI Celera RH 3.4 Map 3 840.41 RGD Cytogenetic Map 3 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scg5 Rat 1,2-dimethylhydrazine decreases expression ISO Scg5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SCG5 mRNA CTD PMID:22206623 Scg5 Rat 1,2-dimethylhydrazine multiple interactions ISO Scg5 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of SCG5 mRNA] CTD PMID:22206623 Scg5 Rat 17alpha-ethynylestradiol affects expression ISO Scg5 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SCG5 mRNA CTD PMID:17555576 Scg5 Rat 17alpha-ethynylestradiol multiple interactions ISO Scg5 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of SCG5 mRNA CTD PMID:17942748 Scg5 Rat 17alpha-ethynylestradiol decreases expression ISO Scg5 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of SCG5 mRNA CTD PMID:17942748 Scg5 Rat 17beta-estradiol multiple interactions ISO SCG5 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of SCG5 mRNA CTD PMID:30165855 Scg5 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO SCG5 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 and PMID:38568856 Scg5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Scg5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SCG5 mRNA CTD PMID:16611356 Scg5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SCG5 mRNA CTD PMID:32109520 Scg5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SCG5 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SCG5 mRNA CTD PMID:22298810 Scg5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Scg5 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of SCG5 mRNA CTD PMID:17942748 Scg5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Scg5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCG5 mRNA CTD PMID:17942748 Scg5 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Scg5 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO SCG5 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Scg5 Rat 2-palmitoylglycerol increases expression ISO SCG5 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SCG5 mRNA CTD PMID:37199045 Scg5 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO SCG5 (Homo sapiens) 6480464 3 more ... CTD PMID:21703328 Scg5 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO SCG5 (Homo sapiens) 6480464 3 more ... CTD PMID:29947894 Scg5 Rat 3,4-dichloroaniline increases expression ISO SCG5 (Homo sapiens) 6480464 3 and 4-dichloroaniline results in increased expression of SCG5 mRNA CTD PMID:24172598 Scg5 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SCG5 mRNA CTD PMID:30071829 Scg5 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of SCG5 mRNA CTD PMID:23358152 Scg5 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Scg5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SCG5 mRNA CTD PMID:18648102 Scg5 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SCG5 mRNA CTD PMID:36041667 Scg5 Rat 5-aza-2'-deoxycytidine increases expression ISO SCG5 (Homo sapiens) 6480464 Decitabine results in increased expression of SCG5 mRNA CTD PMID:17334394 Scg5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SCG5 mRNA CTD PMID:30047161 Scg5 Rat aflatoxin B1 affects methylation ISO SCG5 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of SCG5 intron CTD PMID:30157460 Scg5 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of SCG5 mRNA CTD PMID:35163327 Scg5 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SCG5 mRNA CTD PMID:30047161 Scg5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SCG5 mRNA CTD PMID:16483693 Scg5 Rat arsane multiple interactions ISO SCG5 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCG5 mRNA CTD PMID:32525701 Scg5 Rat arsenic atom multiple interactions ISO SCG5 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCG5 mRNA CTD PMID:32525701 Scg5 Rat benzo[a]pyrene increases expression ISO SCG5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SCG5 mRNA CTD PMID:20106945 Scg5 Rat benzo[a]pyrene affects methylation ISO SCG5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SCG5 intron CTD PMID:30157460 Scg5 Rat benzo[a]pyrene decreases expression ISO Scg5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SCG5 mRNA CTD PMID:22228805 Scg5 Rat benzo[a]pyrene decreases expression ISO SCG5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SCG5 mRNA CTD PMID:22316170 Scg5 Rat benzo[a]pyrene diol epoxide I affects expression ISO SCG5 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Scg5 Rat bis(2-ethylhexyl) phthalate decreases expression ISO SCG5 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of SCG5 mRNA CTD PMID:31163220 Scg5 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SCG5 mRNA CTD PMID:30816183 more ... Scg5 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SCG5 mRNA CTD PMID:36041667 Scg5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SCG5 mRNA CTD PMID:25181051 and PMID:34947998 Scg5 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SCG5 mRNA CTD PMID:36041667 Scg5 Rat buta-1,3-diene decreases expression ISO Scg5 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of SCG5 mRNA CTD PMID:29038090 Scg5 Rat butanal increases expression ISO SCG5 (Homo sapiens) 6480464 butyraldehyde results in increased expression of SCG5 mRNA CTD PMID:26079696 Scg5 Rat Butylbenzyl phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat cadmium dichloride decreases expression ISO SCG5 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SCG5 mRNA CTD PMID:26472689 Scg5 Rat cadmium dichloride increases expression ISO SCG5 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SCG5 mRNA CTD PMID:38568856 Scg5 Rat carbamazepine affects expression ISO SCG5 (Homo sapiens) 6480464 Carbamazepine affects the expression of SCG5 mRNA CTD PMID:25979313 Scg5 Rat chlordecone increases expression ISO Scg5 (Mus musculus) 6480464 Chlordecone results in increased expression of SCG5 mRNA CTD PMID:33711761 Scg5 Rat chloropicrin increases expression ISO SCG5 (Homo sapiens) 6480464 chloropicrin results in increased expression of SCG5 mRNA CTD PMID:26352163 Scg5 Rat cisplatin decreases expression ISO SCG5 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SCG5 mRNA CTD PMID:27392435 Scg5 Rat cisplatin multiple interactions ISO SCG5 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SCG5 mRNA CTD PMID:27392435 Scg5 Rat copper atom multiple interactions ISO SCG5 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SCG5 mRNA CTD PMID:20971185 Scg5 Rat copper(0) multiple interactions ISO SCG5 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SCG5 mRNA CTD PMID:20971185 Scg5 Rat copper(II) chloride increases expression ISO SCG5 (Homo sapiens) 6480464 cupric chloride results in increased expression of SCG5 mRNA CTD PMID:38568856 Scg5 Rat cyclosporin A increases expression ISO SCG5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SCG5 mRNA CTD PMID:20106945 and PMID:27989131 Scg5 Rat diallyl trisulfide increases expression ISO SCG5 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of SCG5 mRNA CTD PMID:34995734 Scg5 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SCG5 mRNA CTD PMID:21266533 Scg5 Rat dibutyl phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat diethyl phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat diisobutyl phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat diisononyl phthalate multiple interactions ISO Scg5 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SCG5 mRNA CTD PMID:39150890 Scg5 Rat diuron increases expression ISO SCG5 (Homo sapiens) 6480464 Diuron metabolite results in increased expression of SCG5 mRNA CTD PMID:24172598 Scg5 Rat ethanol multiple interactions ISO Scg5 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SCG5 mRNA CTD PMID:30319688 Scg5 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SCG5 mRNA CTD PMID:30307764 Scg5 Rat folic acid multiple interactions ISO Scg5 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of SCG5 mRNA] CTD PMID:22206623 Scg5 Rat formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of SCG5 mRNA CTD PMID:12679049 Scg5 Rat formaldehyde decreases expression ISO SCG5 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SCG5 mRNA CTD PMID:28937961 Scg5 Rat formaldehyde increases expression ISO SCG5 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SCG5 mRNA CTD PMID:27664576 Scg5 Rat furan increases expression EXP 6480464 furan results in increased expression of SCG5 mRNA CTD PMID:26194646 and PMID:27387713 Scg5 Rat hydroquinone increases expression ISO SCG5 (Homo sapiens) 6480464 hydroquinone results in increased expression of SCG5 mRNA CTD PMID:31256213 Scg5 Rat malathion increases expression ISO SCG5 (Homo sapiens) 6480464 Malathion results in increased expression of SCG5 mRNA CTD PMID:37047231 Scg5 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of SCG5 mRNA CTD PMID:23358152 Scg5 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SCG5 mRNA CTD PMID:30047161 Scg5 Rat methylisothiazolinone increases expression ISO SCG5 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of SCG5 mRNA CTD PMID:31629900 Scg5 Rat mitomycin C affects response to substance ISO SCG5 (Homo sapiens) 6480464 SCG5 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Scg5 Rat mono(2-ethylhexyl) phthalate decreases expression ISO SCG5 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SCG5 mRNA CTD PMID:38685446 Scg5 Rat monosodium L-glutamate increases expression ISO Scg5 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of SCG5 mRNA CTD PMID:22078008 Scg5 Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of SCG5 mRNA CTD PMID:15585946 Scg5 Rat paclitaxel affects response to substance ISO SCG5 (Homo sapiens) 6480464 SCG5 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Scg5 Rat paracetamol affects expression ISO SCG5 (Homo sapiens) 6480464 Acetaminophen affects the expression of SCG5 mRNA CTD PMID:26690555 Scg5 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SCG5 mRNA CTD PMID:33387578 Scg5 Rat paracetamol increases expression ISO SCG5 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SCG5 mRNA CTD PMID:29067470 Scg5 Rat PD 0325901 multiple interactions ISO SCG5 (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with mirdametinib] results in decreased expression of SCG5 mRNA CTD PMID:25119042 Scg5 Rat perfluorohexanesulfonic acid increases expression ISO Scg5 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SCG5 mRNA CTD PMID:37995155 Scg5 Rat perfluorononanoic acid increases expression ISO SCG5 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of SCG5 mRNA CTD PMID:32588087 Scg5 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] affects the expression of SCG5 mRNA CTD PMID:35163327 Scg5 Rat pirinixic acid multiple interactions ISO SCG5 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SCG5 mRNA CTD PMID:19710929 Scg5 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of SCG5 mRNA CTD PMID:23358152 Scg5 Rat quercetin increases expression ISO SCG5 (Homo sapiens) 6480464 Quercetin results in increased expression of SCG5 mRNA CTD PMID:21632981 Scg5 Rat silicon dioxide affects expression ISO SCG5 (Homo sapiens) 6480464 Silicon Dioxide analog affects the expression of SCG5 mRNA CTD PMID:25895662 Scg5 Rat silicon dioxide increases expression ISO SCG5 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of SCG5 mRNA CTD PMID:25351596 Scg5 Rat sodium arsenate multiple interactions ISO SCG5 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCG5 mRNA CTD PMID:32525701 Scg5 Rat sodium arsenite decreases expression ISO SCG5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SCG5 mRNA CTD PMID:29301061 and PMID:35954277 Scg5 Rat sodium arsenite decreases expression ISO Scg5 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SCG5 mRNA CTD PMID:37682722 Scg5 Rat sodium arsenite increases expression ISO SCG5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SCG5 mRNA CTD PMID:38568856 Scg5 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of SCG5 mRNA CTD PMID:19281266 Scg5 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SCG5 mRNA CTD PMID:30047161 Scg5 Rat sunitinib decreases expression ISO SCG5 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SCG5 mRNA CTD PMID:31533062 Scg5 Rat tamoxifen affects expression ISO Scg5 (Mus musculus) 6480464 Tamoxifen affects the expression of SCG5 mRNA CTD PMID:17555576 Scg5 Rat taurine increases expression ISO SCG5 (Homo sapiens) 6480464 Taurine results in increased expression of SCG5 mRNA CTD PMID:16579726 Scg5 Rat temozolomide decreases expression ISO SCG5 (Homo sapiens) 6480464 Temozolomide results in decreased expression of SCG5 mRNA CTD PMID:31758290 Scg5 Rat tert-butyl hydroperoxide increases expression ISO SCG5 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of SCG5 mRNA CTD PMID:15336504 Scg5 Rat thiram increases expression ISO SCG5 (Homo sapiens) 6480464 Thiram results in increased expression of SCG5 mRNA CTD PMID:38568856 Scg5 Rat urethane decreases expression ISO SCG5 (Homo sapiens) 6480464 Urethane results in decreased expression of SCG5 mRNA CTD PMID:28818685 Scg5 Rat valproic acid increases expression ISO SCG5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SCG5 mRNA CTD PMID:23179753 and PMID:29154799 Scg5 Rat valproic acid affects expression ISO SCG5 (Homo sapiens) 6480464 Valproic Acid affects the expression of SCG5 mRNA CTD PMID:25979313 Scg5 Rat zoledronic acid increases expression ISO SCG5 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SCG5 mRNA CTD PMID:24714768
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-dichloroaniline (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3,7-dihydropurine-6-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (EXP) buta-1,3-diene (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) carbamazepine (ISO) chlordecone (ISO) chloropicrin (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) cyclosporin A (ISO) diallyl trisulfide (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diuron (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) formaldehyde (EXP,ISO) furan (EXP) hydroquinone (ISO) malathion (ISO) mercaptopurine (EXP) methimazole (EXP) methylisothiazolinone (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) paclitaxel (EXP,ISO) paracetamol (EXP,ISO) PD 0325901 (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) purine-6-thiol (EXP) quercetin (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) taurine (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thiram (ISO) urethane (ISO) valproic acid (ISO) zoledronic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.
Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway.
Lee SN, etal., J Biol Chem. 2006 Feb 10;281(6):3312-20. Epub 2005 Nov 14.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
12.
Cloning and characterization of the rat complementary deoxyribonucleic acid and gene encoding the neuroendocrine peptide 7B2.
Waldbieser GC, etal., Endocrinology 1991 Jun;128(6):3228-36.
Scg5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 120,998,420 - 121,042,881 (-) NCBI GRCr8 mRatBN7.2 3 100,544,101 - 100,588,558 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 100,544,099 - 100,588,463 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 104,171,047 - 104,215,378 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 112,770,077 - 112,814,414 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 110,459,966 - 110,504,303 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 105,235,065 - 105,279,475 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 105,235,050 - 105,279,462 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 111,811,718 - 111,856,212 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 99,629,194 - 99,674,523 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 99,525,619 - 99,570,949 (-) NCBI Celera 3 99,515,552 - 99,558,902 (-) NCBI Celera RH 3.4 Map 3 840.41 RGD Cytogenetic Map 3 q35 NCBI
SCG5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 32,641,710 - 32,697,092 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 32,641,676 - 32,697,098 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 32,933,911 - 32,989,293 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 30,721,252 - 30,776,590 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 30,721,251 - 30,776,590 NCBI Celera 15 9,735,550 - 9,791,154 (+) NCBI Celera Cytogenetic Map 15 q13.3 NCBI HuRef 15 9,796,189 - 9,851,652 (+) NCBI HuRef CHM1_1 15 33,051,914 - 33,107,353 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 30,438,200 - 30,493,619 (+) NCBI T2T-CHM13v2.0
Scg5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 113,606,708 - 113,659,423 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 113,606,707 - 113,659,466 (-) Ensembl GRCm39 Ensembl GRCm38 2 113,776,313 - 113,829,091 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 113,776,362 - 113,829,121 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 113,616,470 - 113,669,248 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 113,577,206 - 113,629,965 (-) NCBI MGSCv36 mm8 Celera 2 114,909,627 - 114,958,933 (-) NCBI Celera Cytogenetic Map 2 E4 NCBI cM Map 2 57.45 NCBI
Scg5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 1,866,997 - 1,914,640 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 1,867,848 - 1,914,505 (-) NCBI ChiLan1.0 ChiLan1.0
SCG5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 21,409,656 - 21,465,388 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 26,131,284 - 26,187,027 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 11,136,920 - 11,192,606 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 29,974,633 - 30,030,291 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 29,974,633 - 30,030,291 (+) Ensembl panpan1.1 panPan2
SCG5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 2,261,144 - 2,315,315 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 2,261,189 - 2,315,213 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 2,310,629 - 2,364,774 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 2,373,662 - 2,427,835 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 2,373,665 - 2,427,885 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 2,310,404 - 2,364,530 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 2,409,276 - 2,463,487 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 2,537,616 - 2,591,809 (-) NCBI UU_Cfam_GSD_1.0
Scg5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 80,784,633 - 80,839,707 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936673 1,311,861 - 1,367,237 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936673 1,312,183 - 1,367,205 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCG5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 136,525,944 - 136,593,583 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 136,525,920 - 136,590,021 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 152,695,828 - 152,711,796 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCG5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 50,182,966 - 50,243,284 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 50,189,473 - 50,243,282 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 90,640,439 - 90,694,840 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scg5
.
Predicted Target Of
Count of predictions: 67 Count of miRNA genes: 50 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000010679 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1582252 Sual1 Serum uric acid level QTL 1 3.4 0.0123 blood uric acid amount (VT:0010302) blood uric acid level (CMO:0000501) 3 96127817 102200699 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH94440
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 100,544,122 - 100,544,280 (+) MAPPER mRatBN7.2 Rnor_6.0 3 105,235,087 - 105,235,244 NCBI Rnor6.0 Rnor_5.0 3 111,811,743 - 111,811,900 UniSTS Rnor5.0 RGSC_v3.4 3 99,629,212 - 99,629,369 UniSTS RGSC3.4 Celera 3 99,515,570 - 99,515,727 UniSTS RH 3.4 Map 3 840.41 UniSTS Cytogenetic Map 3 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
113
90
89
58
25
58
6
216
96
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010679 ⟹ ENSRNOP00000010679
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 100,544,099 - 100,588,463 (-) Ensembl Rnor_6.0 Ensembl 3 105,235,050 - 105,279,462 (-) Ensembl
RefSeq Acc Id:
NM_013175 ⟹ NP_037307
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 120,998,420 - 121,042,795 (-) NCBI mRatBN7.2 3 100,544,102 - 100,588,473 (-) NCBI Rnor_6.0 3 105,235,069 - 105,279,399 (-) NCBI Rnor_5.0 3 111,811,718 - 111,856,212 (-) NCBI RGSC_v3.4 3 99,629,194 - 99,674,523 (-) RGD Celera 3 99,515,552 - 99,558,902 (-) RGD
Sequence:
AGATTGCTAGACGCTCGCCCGCGGCCACACGGTTAAAAATGACCTCAAGGATGGCCATACTATCTGGTCTTTTGTTTTGGCTGCTGCTTGAGTGGAATCCAGCATTCGCTTATAGTCCACGGACTCCT
hide sequence
RefSeq Acc Id:
XM_006234701 ⟹ XP_006234763
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 120,998,420 - 121,042,881 (-) NCBI mRatBN7.2 3 100,544,101 - 100,588,558 (-) NCBI Rnor_6.0 3 105,235,065 - 105,279,475 (-) NCBI Rnor_5.0 3 111,811,718 - 111,856,212 (-) NCBI
Sequence:
GGGGCCTGGGTGGAGCTTGGTTGCGGAGGGAGGTGACGCAGGAGCTATCCAGCACGTCAGCTCCCTGTTTTGGCCCAGATTGCTAGACGCCCGCCCGCGGCCACACGGTTAAAAATGACCTCAAGGAT
hide sequence
RefSeq Acc Id:
NP_037307 ⟸ NM_013175
- Peptide Label:
precursor
- UniProtKB:
P27682 (UniProtKB/Swiss-Prot), G3V714 (UniProtKB/TrEMBL), A6HP67 (UniProtKB/TrEMBL)
- Sequence:
MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGC
hide sequence
RefSeq Acc Id:
XP_006234763 ⟸ XM_006234701
- Peptide Label:
isoform X1
- UniProtKB:
P27682 (UniProtKB/Swiss-Prot)
- Sequence:
MTSRMVILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTDDGCL
hide sequence
Ensembl Acc Id:
ENSRNOP00000010679 ⟸ ENSRNOT00000010679
RGD ID: 13692296 Promoter ID: EPDNEW_R2821 Type: multiple initiation site Name: Scg5_1 Description: secretogranin V SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 105,279,399 - 105,279,459 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-03-26
Scg5
secretogranin V
Scg5
secretogranin V (7B2 protein)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-02-02
Scg5
secretogranin V (7B2 protein)
Scg5
secretogranin V
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-12
Scg5
secretogranin V
Sgne1
secretory granule neuroendocrine protein 1
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2002-06-10
Sgne1
Secretory granule neuroendocrine, protein 1 (7B2 protein)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the pituitary and in brain
729678
