Advanced Search (OLGA)

Gene: Rgs7 (regulator of G-protein signaling 7) Rattus norvegicus

Analyze

Symbol:

Rgs7

Name:

regulator of G-protein signaling 7

RGD ID:

3570

Description:

Enables G-protein alpha-subunit binding activity and G-protein beta-subunit binding activity. Involved in several processes, including positive regulation of potassium ion transmembrane transport; response to amphetamine; and response to ethanol. Located in nuclear envelope. Part of protein-containing complex. Orthologous to human RGS7 (regulator of G protein signaling 7); PARTICIPATES IN dopamine signaling pathway via D1 family of receptors; dopamine signaling pathway via D2 family of receptors; G protein mediated signaling pathway via Galphai family; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RGS7 (regulator of G protein signaling 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Rgs7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rgs7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RGS7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RGS7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rgs7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RGS7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RGS7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rgs7 (regulator of G protein signaling 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RGS7 (regulator of G protein signaling 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rgs7 (regulator of G protein signaling 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rgs7a (regulator of G protein signaling 7a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rgs7b (regulator of G protein signaling 7b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	egl-10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RSG7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	89,511,492 - 89,941,082 (-)	NCBI		GRCr8
mRatBN7.2	13	86,979,269 - 87,408,834 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	86,979,279 - 87,408,888 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	89,484,142 - 89,917,175 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	90,884,436 - 91,317,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	88,061,466 - 88,488,430 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	93,095,659 - 93,534,452 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	93,095,200 - 93,307,199 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	97,560,710 - 97,998,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	90,732,429 - 91,210,368 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	90,921,312 - 91,400,404 (-)	NCBI
Celera	13	86,580,200 - 87,006,930 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Seizures (IEP)

gastrointestinal stromal tumor (ISO)

Hereditary Leiomyomatosis and Renal Cell Cancer (ISO)

intellectual disability (ISO)

Neurodevelopmental Disorders (ISO)

parathyroid carcinoma (ISO)

Stroke (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,3,5-trinitro-1,3,5-triazinane (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

clozapine (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

curcumin (ISO)

dextran sulfate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

fulvestrant (ISO)

genistein (ISO)

lead(0) (ISO)

maneb (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

olanzapine (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

paraquat (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

quercetin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

WIN 55212-2 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

intracellular signal transduction (IEA)

negative regulation of G protein-coupled receptor signaling pathway (ISO,ISS)

negative regulation of signal transduction (IEA)

positive regulation of GTPase activity (ISO)

positive regulation of potassium ion transmembrane transport (IDA)

regulation of G protein-coupled receptor signaling pathway (IDA,IEA,ISO)

regulation of postsynaptic membrane potential (ISO)

response to amphetamine (IEP)

response to ethanol (IEP)

Cellular Component

cell tip (ISO)

cytoplasm (IBA)

cytosol (ISO)

dendrite (ISO)

dendrite terminus (ISO)

glutamatergic synapse (ISO)

neuron projection (IBA)

nuclear envelope (IDA)

nucleus (ISO)

plasma membrane (IBA,ISO)

postsynaptic membrane (ISO)

presynapse (ISO)

presynaptic membrane (ISO)

protein-containing complex (IDA)

Molecular Function

G-protein alpha-subunit binding (IDA,ISO)

G-protein beta-subunit binding (IPI,ISO)

GTPase activator activity (IBA,ISO,ISS)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

dopamine signaling pathway via D1 family of receptors (ISO)

dopamine signaling pathway via D2 family of receptors (ISO)

G protein mediated signaling pathway via Galphai family (ISO)

G protein mediated signaling pathway via Galphas family (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The physiology, signaling, and pharmacology of dopamine receptors.	Beaulieu JM and Gainetdinov RR, Pharmacol Rev. 2011 Mar;63(1):182-217. doi: 10.1124/pr.110.002642. Epub 2011 Feb 8.
2.	A region-specific increase in Galphaq and Galpha11 proteins in brains of rats during cocaine withdrawal.	Carrasco GA, etal., J Pharmacol Exp Ther. 2003 Dec;307(3):1012-9. Epub 2003 Oct 8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Regulation of regulators of G protein signaling mRNA expression in rat brain by acute and chronic electroconvulsive seizures.	Gold SJ, etal., J Neurochem. 2002 Aug;82(4):828-38.
6.	Postnatal induction and localization of R7BP, a membrane-anchoring protein for regulator of G protein signaling 7 family-Gbeta5 complexes in brain.	Grabowska D, etal., Neuroscience. 2008 Feb 19;151(4):969-82. doi: 10.1016/j.neuroscience.2007.11.045. Epub 2007 Dec 8.
7.	Spinal cord injury induces expression of RGS7 in microglia/macrophages in rats.	Hausmann ON, etal., Eur J Neurosci. 2002 Feb;15(4):602-12.
8.	Expression of RGS2, RGS4 and RGS7 in the developing postnatal brain.	Ingi T and Aoki Y, Eur J Neurosci. 2002 Mar;15(5):929-36.
9.	Chronic cold exposure increases RGS7 expression and decreases alpha(2)-autoreceptor-mediated inhibition of noradrenergic locus coeruleus neurons.	Jedema HP, etal., Eur J Neurosci. 2008 May;27(9):2433-43.
10.	EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.	Koelle MR and Horvitz HR, Cell 1996 Jan 12;84(1):115-25.
11.	Chronic intermittent ethanol exposure selectively alters the expression of Ga subunit isoforms and RGS subtypes in rat prefrontal cortex.	Luessen DJ, etal., Brain Res. 2017 Oct 1;1672:106-112. doi: 10.1016/j.brainres.2017.07.014. Epub 2017 Jul 21.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	RGS7 and RGS8 differentially accelerate G protein-mediated modulation of K+ currents.	Saitoh O, etal., J Biol Chem 1999 Apr 2;274(14):9899-904.
18.	The brain gene expression profile of dopamine D2/D3 receptors and associated signaling proteins following amphetamine self-administration.	Sun H, etal., Neuroscience. 2015 Oct 29;307:253-61. doi: 10.1016/j.neuroscience.2015.08.053. Epub 2015 Aug 28.
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	Complexes of the G protein subunit gbeta 5 with the regulators of G protein signaling RGS7 and RGS9. Characterization in native tissues and in transfected cells.	Witherow DS, etal., J Biol Chem. 2000 Aug 11;275(32):24872-80.

Additional References at PubMed

PMID:9315921	PMID:10521509	PMID:15897264	PMID:19376773	PMID:21343290	PMID:22689652	PMID:22871113	PMID:24755289	PMID:27965545

Genomics

Comparative Map Data

Rgs7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	89,511,492 - 89,941,082 (-)	NCBI		GRCr8
mRatBN7.2	13	86,979,269 - 87,408,834 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	86,979,279 - 87,408,888 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	89,484,142 - 89,917,175 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	90,884,436 - 91,317,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	88,061,466 - 88,488,430 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	93,095,659 - 93,534,452 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	93,095,200 - 93,307,199 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	97,560,710 - 97,998,950 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	90,732,429 - 91,210,368 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	90,921,312 - 91,400,404 (-)	NCBI
Celera	13	86,580,200 - 87,006,930 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

RGS7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	240,774,742 - 241,357,230 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	240,767,636 - 241,357,374 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	240,938,042 - 241,520,530 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	239,005,440 - 239,587,101 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	237,264,911 - 237,846,519	NCBI
Celera	1	214,195,486 - 214,775,530 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI
HuRef	1	211,396,767 - 211,978,931 (-)	NCBI		HuRef
CHM1_1	1	242,211,139 - 242,793,223 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	240,186,136 - 240,768,709 (-)	NCBI		T2T-CHM13v2.0

Rgs7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	174,886,642 - 175,320,287 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	174,886,653 - 175,320,066 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	175,059,076 - 175,492,862 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	175,059,087 - 175,492,500 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	176,989,207 - 177,422,676 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	176,895,892 - 177,329,065 (-)	NCBI		MGSCv36	mm8
Celera	1	182,147,940 - 182,583,035 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	81.11	NCBI

Rgs7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	10,670,009 - 11,127,757 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	10,669,127 - 11,127,564 (+)	NCBI	ChiLan1.0	ChiLan1.0

RGS7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	7,788,859 - 8,380,229 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	8,013,025 - 8,603,631 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	216,329,373 - 216,919,898 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	221,313,329 - 221,899,673 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	221,313,924 - 221,899,627 (-)	Ensembl	panpan1.1		panPan2

RGS7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	32,296,337 - 32,792,085 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	32,296,695 - 32,792,036 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	31,844,360 - 32,355,859 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	32,121,410 - 32,620,141 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	32,121,410 - 32,618,757 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	31,959,165 - 32,454,995 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	31,990,446 - 32,479,343 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	32,231,779 - 32,720,515 (-)	NCBI		UU_Cfam_GSD_1.0

Rgs7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	45,194,086 - 45,660,702 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936526	9,088,350 - 9,551,899 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936526	9,087,820 - 9,552,482 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RGS7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	11,950,901 - 12,322,359 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	11,950,897 - 12,322,382 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	14,263,678 - 14,421,091 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RGS7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	77,876,831 - 78,444,732 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	77,876,833 - 78,191,928 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	79,989,999 - 80,571,537 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rgs7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	11,206,421 - 11,723,749 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	11,205,772 - 11,724,980 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rgs7
3003 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	74
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000065041
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Markers in Region

D13Rat187

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	89,773,194 - 89,773,402 (+)	Marker Load Pipeline
mRatBN7.2	13	87,240,998 - 87,241,206 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,368,290 - 93,368,497	NCBI	Rnor6.0
Rnor_5.0	13	97,832,701 - 97,832,908	UniSTS	Rnor5.0
RGSC_v3.4	13	91,043,346 - 91,043,554	RGD	RGSC3.4
RGSC_v3.4	13	91,043,347 - 91,043,554	UniSTS	RGSC3.4
RGSC_v3.1	13	91,232,231 - 91,232,438	RGD
Celera	13	86,839,776 - 86,839,983	UniSTS
RH 3.4 Map	13	583.4	UniSTS
RH 3.4 Map	13	583.4	RGD
RH 2.0 Map	13	633.1	RGD
SHRSP x BN Map	13	40.7498	RGD
Cytogenetic Map	13	q24-q25	UniSTS

D13Uia7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	87,311,410 - 87,311,565 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,438,419 - 93,438,573	NCBI	Rnor6.0
Rnor_5.0	13	97,902,797 - 97,902,951	UniSTS	Rnor5.0
RGSC_v3.4	13	91,113,973 - 91,114,128	RGD	RGSC3.4
RGSC_v3.4	13	91,113,974 - 91,114,128	UniSTS	RGSC3.4
RGSC_v3.1	13	91,302,857 - 91,303,012	RGD
Celera	13	86,910,157 - 86,910,311	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

D13Mco21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	89,744,312 - 89,744,427 (+)	Marker Load Pipeline
mRatBN7.2	13	87,212,117 - 87,212,232 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,340,676 - 93,340,790	NCBI	Rnor6.0
Rnor_5.0	13	97,805,084 - 97,805,198	UniSTS	Rnor5.0
RGSC_v3.4	13	91,012,798 - 91,012,913	RGD	RGSC3.4
RGSC_v3.4	13	91,012,799 - 91,012,913	UniSTS	RGSC3.4
RGSC_v3.1	13	91,201,682 - 91,201,797	RGD
Celera	13	86,812,654 - 86,812,768	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

D13Ulb2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	87,016,284 - 87,016,569 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,132,654 - 93,132,936	NCBI	Rnor6.0
Rnor_5.0	13	97,597,607 - 97,597,889	UniSTS	Rnor5.0
RGSC_v3.4	13	90,769,328 - 90,769,610	UniSTS	RGSC3.4
Celera	13	86,617,203 - 86,617,485	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

RH131359

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	86,979,344 - 86,979,548 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,095,723 - 93,095,926	NCBI	Rnor6.0
Rnor_5.0	13	97,560,774 - 97,560,977	UniSTS	Rnor5.0
RGSC_v3.4	13	90,732,493 - 90,732,696	UniSTS	RGSC3.4
Celera	13	86,580,264 - 86,580,467	UniSTS
RH 3.4 Map	13	585.8	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

RH134962

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	87,358,211 - 87,358,361 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,485,214 - 93,485,363	NCBI	Rnor6.0
Rnor_5.0	13	97,949,592 - 97,949,741	UniSTS	Rnor5.0
RGSC_v3.4	13	91,160,769 - 91,160,918	UniSTS	RGSC3.4
Celera	13	86,956,950 - 86,957,099	UniSTS
RH 3.4 Map	13	585.0	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

BF402644

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	87,365,385 - 87,365,492 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,492,388 - 93,492,494	NCBI	Rnor6.0
Rnor_5.0	13	97,956,766 - 97,956,872	UniSTS	Rnor5.0
RGSC_v3.4	13	91,167,943 - 91,168,049	UniSTS	RGSC3.4
Celera	13	86,964,065 - 86,964,171	UniSTS
RH 3.4 Map	13	583.4	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

AU046960

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	87,370,449 - 87,370,564 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	93,497,409 - 93,497,523	NCBI	Rnor6.0
Rnor_5.0	13	97,961,812 - 97,961,926	UniSTS	Rnor5.0
RGSC_v3.4	13	91,173,326 - 91,173,440	UniSTS	RGSC3.4
Celera	13	86,969,125 - 86,969,239	UniSTS
Cytogenetic Map	13	q24-q25	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	35	113	64	63	32	25	32	6	176	82	93	45	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019343	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB024398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC109958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065041 ⟹ ENSRNOP00000063631

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,979,279 - 87,179,776 (-)	Ensembl
Rnor_6.0 Ensembl	13	93,095,200 - 93,307,199 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106278 ⟹ ENSRNOP00000094085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,995,343 - 87,408,693 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107041 ⟹ ENSRNOP00000076773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,979,490 - 87,408,888 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112294 ⟹ ENSRNOP00000090982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,979,490 - 87,408,888 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116817 ⟹ ENSRNOP00000082844

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	86,979,279 - 87,408,609 (-)	Ensembl

RefSeq Acc Id:

NM_019343 ⟹ NP_062216

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,511,492 - 89,941,050 (-)	NCBI
mRatBN7.2	13	86,979,279 - 87,408,825 (-)	NCBI
Rnor_6.0	13	93,095,659 - 93,534,452 (-)	NCBI
Rnor_5.0	13	97,560,710 - 97,998,950 (-)	NCBI
RGSC_v3.4	13	90,732,429 - 91,210,368 (-)	RGD
Celera	13	86,580,200 - 87,006,930 (-)	RGD

Sequence:

show sequence

TGAGGCCGCCTTGGCCGAGGAGGGCAGACTGATCATCCTTGTATCTGAGCTACCAAGTTCTGTG
TGAAATGGCTCAGGGGAATAATTATGGCCAGACCAGCAATGGGGTGGCAGAGGAATCACCGAAC
ATGCTGGTGTACAGAAAGATGGAAGATGTCATAGCACGTATGCAAGATGAAAAAAATGGAATTC
CCATCCGTACCGTCAAAAGCTTCCTTTCCAAGATCCCCAGTGTTTTCTCTGGGTCAGACATTGT
TCAGTGGTTAATAAAGAACTTAACTATAGAAGATCCAGTGGAGGCTCTCCATTTGGGAACGCTA
ATGGCTGCCCATGGCTACTTCTTTCCCATCTCAGATCATGTCCTCACACTCAAGGATGATGGCA
CCTTCTACCGGTTTCAAACACCCTATTTTTGGCCGTCAAATTGTTGGGAGCCAGAAAACACAGA
CTATGCTGTTTACCTCTGCAAGAGAACAATGCAAAACAAGGCAAGGCTAGAGCTAGCAGACTAC
GAAGCCGAGAGCCTGGCCAGGCTGCAGAGGGCATTTGCCCGGAAGTGGGAGTTCATTTTTATGC
AAGCAGAAGCACAAGCTAAAGTGGACAAGAAGAGGGACAAAATTGAAAGGAAGATCCTCGATAG
TCAGGAGAGAGCATTCTGGGATGTCCACAGGCCTGTGCCTGGGTGTGTAAATACTACAGAAGTG
GACATCAAGAAATCATCCCGGATGAGAAACCCACACAAAACACGCAAGTCTGTCTATGGTTTAC
AAAATGACATCCGAAGTCACAGTCCCACCCACACACCCACACCAGAAACCAAGCCTCCAACAGA
AGATGAGTTGCACCGACAGATAAAATACTGGCAAATACAGTTAGATAGACATCGGTTAAAAATG
TCAAAAGTTGCTGATAGTCTACTAAGTTATACGGAACAGTATGTAGAGTATGACCCATTTCTTG
TACCGCCTGACCCTTCCAACCCATGGCTCTCAGATGATACGACATTCTGGGAACTTGAAGCAAG
CAAAGAACCAAGTCAACAGAGGGTAAAACGATGGGGTTTTGGCATGGATGAGGCACTGAAAGAC
CCAGTTGGGAGAGAGCAGTTCCTTAAGTTTCTAGAATCAGAATTCAGCTCAGAGAACTTAAGGT
TCTGGTTGGCAGTGGAGGACCTGAAGAAAAGGCCTATCCGAGAGGTCCCCTCTCGAGTACAGGA
AATATGGCAAGAATTTCTGGCTCCGGGGGCCCCCAGTGCCATTAACTTGGATTCGAAGAGTTAT
GACAAGACCACACAGAATGTGAAGGAACCAGGACGATACACATTCGAAGATGCTCAGGAGCACA
TTTACAAGCTGATGAAGAGTGACTCATACCCCCGCTTTATAAGATCTAGTGCCTACCAGGAACT
TCTACAGGCAAAGAGAAAGGGCAGAAACATCCCTATTTTCCCATGCCATAAAAACTGTACACCA
ACACTGAGGGCCAGCACTAACCTGTTATGAAAAGAGGGGAAATCTCTCACATCCAAGAGGTTAA
CAAGCCTTGTTCAGTCTTACTAAAAGGATCGTCTTCGTCACATGAGAGCTGGACGGAGCCATCG
CCCATACCTTGTAGCCCATCGCGCTGTTACCTGGAGCCAAGGATGTTAGACCAAGATGTTGCAT
GAATGAAGGACCTGAGTTGTTCTGTGTGCACATAAAGGCATCACATTTGCCAAGGGACACTGTC
ATCTCATTGCCTCCATCTTCCCGTGCCGTTTGCTTCCCTCTCTCCTCGTACTAAGCTGGATCTG
TGTCCTTTTCTTTTTAACGAGTTCAAGTGAAGGAAAACTTTATTTGTCCCCCCTTCCTCTCTTT
TTCTTAAAGCTTCTGCTAGATGCACAGTTCACTGAAAATTCAGTCAGTCACAAACTGGAAGAAT
TGTAAAAGAAAAAAAAGTATACATCACTAAGTACACACGTGGCTTCACATCTATTAAATAATAA
ATTGGCATGGAAGGAAGGTGTCATTTCACCCGTGTATCCACAGTCTTAAGCAAGCGCCCATCTT
CATCTGTTCTCTGGACATTGTCTGTTCATGTTTCTTGCATTTATTTTTATACCATATTTAAATG
AGAAAACACCTTTTACTCCAGATGTATCAAAGTTGACCTCTTCTCTGTAAATTTGTGTATGTTT
ATATTGTTGTTTTATCTTTCATTAAAAGATGCAGAATCTC

hide sequence

RefSeq Acc Id:

XM_039091028 ⟹ XP_038946956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,512,142 - 89,940,696 (-)	NCBI
mRatBN7.2	13	86,979,269 - 87,408,425 (-)	NCBI

RefSeq Acc Id:

XM_039091029 ⟹ XP_038946957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,512,142 - 89,940,454 (-)	NCBI
mRatBN7.2	13	86,979,269 - 87,408,104 (-)	NCBI

RefSeq Acc Id:

XM_039091030 ⟹ XP_038946958

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,512,062 - 89,941,056 (-)	NCBI
mRatBN7.2	13	86,979,269 - 87,408,834 (-)	NCBI

RefSeq Acc Id:

XM_039091031 ⟹ XP_038946959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,511,494 - 89,941,056 (-)	NCBI
mRatBN7.2	13	86,979,269 - 87,408,833 (-)	NCBI

RefSeq Acc Id:

XM_039091032 ⟹ XP_038946960

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,512,141 - 89,941,035 (-)	NCBI
mRatBN7.2	13	86,979,269 - 87,408,834 (-)	NCBI

RefSeq Acc Id:

XM_063272559 ⟹ XP_063128629

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,511,494 - 89,940,454 (-)	NCBI

RefSeq Acc Id:

XM_063272560 ⟹ XP_063128630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,511,494 - 89,940,755 (-)	NCBI

RefSeq Acc Id:

XM_063272561 ⟹ XP_063128631

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	89,511,494 - 89,941,082 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062216	(Get FASTA)	NCBI Sequence Viewer
	XP_038946956	(Get FASTA)	NCBI Sequence Viewer
	XP_038946957	(Get FASTA)	NCBI Sequence Viewer
	XP_038946958	(Get FASTA)	NCBI Sequence Viewer
	XP_038946959	(Get FASTA)	NCBI Sequence Viewer
	XP_038946960	(Get FASTA)	NCBI Sequence Viewer
	XP_063128629	(Get FASTA)	NCBI Sequence Viewer
	XP_063128630	(Get FASTA)	NCBI Sequence Viewer
	XP_063128631	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52368	(Get FASTA)	NCBI Sequence Viewer
	BAA75635	(Get FASTA)	NCBI Sequence Viewer
	EDL94767	(Get FASTA)	NCBI Sequence Viewer
	EDL94768	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063631.3
	ENSRNOP00000076773.1
	ENSRNOP00000082844.1
	ENSRNOP00000090982.1
	ENSRNOP00000094085.1
	ENSRNOP00055032125
	ENSRNOP00060039417
	ENSRNOP00065030551
GenBank Protein	P49803	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062216 ⟸ NM_019343

- UniProtKB:

Q9R0R0 (UniProtKB/Swiss-Prot), P49803 (UniProtKB/Swiss-Prot), A6JGB2 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAQGNNYGQTSNGVAEESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQ
WLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDY
AVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQ
ERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTED
ELHRQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEASK
EPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEI
WQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELL
QAKRKGRNIPIFPCHKNCTPTLRASTNLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000063631 ⟸ ENSRNOT00000065041

RefSeq Acc Id:	XP_038946960 ⟸ XM_039091032
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038946958 ⟸ XM_039091030
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5YBW3 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038946959 ⟸ XM_039091031
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AAQ8 (UniProtKB/TrEMBL), A6JGB1 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038946956 ⟸ XM_039091028
- Peptide Label:	isoform X1
- UniProtKB:	P49803 (UniProtKB/Swiss-Prot), Q9R0R0 (UniProtKB/Swiss-Prot), A6JGB2 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038946957 ⟸ XM_039091029
- Peptide Label:	isoform X1
- UniProtKB:	P49803 (UniProtKB/Swiss-Prot), Q9R0R0 (UniProtKB/Swiss-Prot), A6JGB2 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000082844 ⟸ ENSRNOT00000116817

Ensembl Acc Id:

ENSRNOP00000076773 ⟸ ENSRNOT00000107041

Ensembl Acc Id:

ENSRNOP00000090982 ⟸ ENSRNOT00000112294

Ensembl Acc Id:

ENSRNOP00000094085 ⟸ ENSRNOT00000106278

RefSeq Acc Id:	XP_063128631 ⟸ XM_063272561
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128630 ⟸ XM_063272560
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AAQ8 (UniProtKB/TrEMBL), A6JGB1 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128629 ⟸ XM_063272559
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AAQ8 (UniProtKB/TrEMBL), A6JGB1 (UniProtKB/TrEMBL), A0A8I6AKV4 (UniProtKB/TrEMBL)

Protein Domains

DEP G protein gamma RGS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P49803-F1-model_v2	AlphaFold	P49803	1-477	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3570	AgrOrtholog
BioCyc Gene	G2FUF-17241	BioCyc
Ensembl Genes	ENSRNOG00000021984	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055022991	UniProtKB/Swiss-Prot
	ENSRNOG00060027170	UniProtKB/Swiss-Prot
	ENSRNOG00065022162	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000065041.3	UniProtKB/TrEMBL
	ENSRNOT00000106278.1	UniProtKB/TrEMBL
	ENSRNOT00000107041.1	UniProtKB/TrEMBL
	ENSRNOT00000112294.1	UniProtKB/TrEMBL
	ENSRNOT00000116817.1	UniProtKB/Swiss-Prot
	ENSRNOT00055039554	UniProtKB/Swiss-Prot
	ENSRNOT00060047353	UniProtKB/Swiss-Prot
	ENSRNOT00065037779	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.10.1240.60	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.10.167.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4.10.260.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	DEP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GGL_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS6/7/9/11	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS6/7/9/11_DHEX_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_DHEX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_subdomain_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54296	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	54296	ENTREZGENE
PANTHER	LP21163P	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	REGULATOR OF G-PROTEIN SIGNALING 7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_DHEX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rgs7	PhenoGen
PRINTS	RGSPROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	DEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021984	RatGTEx
	ENSRNOG00055022991	RatGTEx
	ENSRNOG00060027170	RatGTEx
	ENSRNOG00065022162	RatGTEx
SMART	DEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GGL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF48097	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF48670	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC208242
UniProt	A0A8I5YBW3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AAQ8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKV4	ENTREZGENE, UniProtKB/TrEMBL
	A6JGB1	ENTREZGENE, UniProtKB/TrEMBL
	A6JGB2	ENTREZGENE, UniProtKB/TrEMBL
	D3ZWG2_RAT	UniProtKB/TrEMBL
	P49803	ENTREZGENE
	Q9R0R0	ENTREZGENE
	RGS7_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9R0R0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rgs7	regulator of G-protein signaling 7			Name updated	70584	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations