Symbol:
Rgs6
Name:
regulator of G-protein signaling 6
RGD ID:
3569
Description:
Enables protein domain specific binding activity. Involved in positive regulation of neuron differentiation. Part of protein-containing complex. Human ortholog(s) of this gene implicated in alcohol dependence. Orthologous to human RGS6 (regulator of G protein signaling 6); PARTICIPATES IN acetylcholine signaling pathway via muscarinic acetylcholine receptor; INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 107,875,883 - 108,527,472 (+) NCBI GRCr8 mRatBN7.2 6 102,264,451 - 102,796,311 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 102,264,447 - 102,824,753 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 102,420,755 - 102,953,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 102,719,975 - 103,253,217 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 102,089,444 - 102,622,685 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 106,310,442 - 106,598,668 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 106,496,992 - 106,602,139 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 114,636,387 - 114,736,790 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 106,470,420 - 106,964,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 106,940,142 - 106,967,896 (+) NCBI Celera 6 100,100,895 - 100,625,650 (+) NCBI Celera Cytogenetic Map 6 q24-q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rgs6 Rat 1,2-dichloroethane increases expression ISO Rgs6 (Mus musculus) 6480464 ethylene dichloride results in increased expression of RGS6 mRNA CTD PMID:28960355 Rgs6 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of RGS6 mRNA CTD PMID:30723492 Rgs6 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Rgs6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RGS6 mRNA CTD PMID:32109520 Rgs6 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Rgs6 Rat 2-palmitoylglycerol increases expression ISO RGS6 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of RGS6 mRNA CTD PMID:37199045 Rgs6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RGS6 mRNA CTD PMID:25825206 Rgs6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RGS6 mRNA CTD PMID:24780913 Rgs6 Rat aflatoxin B1 decreases methylation ISO RGS6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of RGS6 gene CTD PMID:27153756 Rgs6 Rat Aflatoxin B2 alpha increases methylation ISO RGS6 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of RGS6 intron CTD PMID:30157460 Rgs6 Rat amiodarone increases expression ISO RGS6 (Homo sapiens) 6480464 Amiodarone results in increased expression of RGS6 mRNA CTD PMID:19774075 Rgs6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RGS6 mRNA CTD PMID:16483693 Rgs6 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of RGS6 gene CTD PMID:35440735 Rgs6 Rat benzo[a]pyrene decreases expression ISO Rgs6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RGS6 mRNA CTD PMID:22228805 Rgs6 Rat benzo[a]pyrene affects methylation ISO RGS6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RGS6 3' UTR more ... CTD PMID:27901495 and PMID:30157460 Rgs6 Rat benzo[a]pyrene increases methylation ISO RGS6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RGS6 5' UTR and Benzo(a)pyrene results in increased methylation of RGS6 promoter CTD PMID:27901495 Rgs6 Rat benzo[e]pyrene increases methylation ISO RGS6 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of RGS6 intron CTD PMID:30157460 Rgs6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RGS6 mRNA CTD PMID:25181051 Rgs6 Rat bisphenol A multiple interactions ISO RGS6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RGS6 gene CTD PMID:31601247 Rgs6 Rat bisphenol A affects methylation ISO RGS6 (Homo sapiens) 6480464 bisphenol A affects the methylation of RGS6 gene CTD PMID:31601247 Rgs6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RGS6 mRNA CTD PMID:30816183 and PMID:34947998 Rgs6 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of RGS6 mRNA CTD PMID:33453195 Rgs6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of RGS6 mRNA CTD PMID:27523638 Rgs6 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of RGS6 mRNA CTD PMID:26577399 Rgs6 Rat doxorubicin decreases expression ISO RGS6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RGS6 mRNA CTD PMID:29803840 and PMID:30031762 Rgs6 Rat fulvestrant multiple interactions ISO RGS6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RGS6 gene CTD PMID:31601247 Rgs6 Rat genistein decreases expression ISO Rgs6 (Mus musculus) 6480464 Genistein results in decreased expression of RGS6 mRNA CTD PMID:32186404 Rgs6 Rat lead(0) affects expression ISO RGS6 (Homo sapiens) 6480464 Lead affects the expression of RGS6 mRNA CTD PMID:28903495 Rgs6 Rat manganese atom increases expression ISO RGS6 (Homo sapiens) 6480464 Manganese results in increased expression of RGS6 mRNA CTD PMID:17175027 Rgs6 Rat manganese(0) increases expression ISO RGS6 (Homo sapiens) 6480464 Manganese results in increased expression of RGS6 mRNA CTD PMID:17175027 Rgs6 Rat manganese(II) chloride increases expression ISO RGS6 (Homo sapiens) 6480464 manganese chloride results in increased expression of RGS6 mRNA CTD PMID:17175027 Rgs6 Rat methapyrilene increases methylation ISO RGS6 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of RGS6 intron CTD PMID:30157460 Rgs6 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of RGS6 gene CTD PMID:35440735 Rgs6 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Rgs6 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of RGS6 mRNA CTD PMID:22401849 Rgs6 Rat morphine increases expression ISO Rgs6 (Mus musculus) 6480464 Morphine results in increased expression of RGS6 mRNA CTD PMID:21178816 Rgs6 Rat morphine decreases expression ISO Rgs6 (Mus musculus) 597830059 morphine decreases expression of Rgs6 mRNA in central gray substance of midbrain RGD Rgs6 Rat morphine multiple interactions ISO Rgs6 (Mus musculus) 597830059 naloxone cotreated with morphine decreases expression of Rgs6 mRNA in central gray substance of midbrain and striatum RGD Rgs6 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of RGS6 gene CTD PMID:33148267 Rgs6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of RGS6 mRNA CTD PMID:20360939 Rgs6 Rat nickel atom increases expression ISO RGS6 (Homo sapiens) 6480464 Nickel results in increased expression of RGS6 mRNA CTD PMID:23195993 Rgs6 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of RGS6 mRNA CTD PMID:32680482 Rgs6 Rat perfluorohexanesulfonic acid increases expression ISO RGS6 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of RGS6 mRNA CTD PMID:25812627 Rgs6 Rat perfluorononanoic acid increases expression ISO RGS6 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of RGS6 mRNA CTD PMID:25812627 Rgs6 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of RGS6 gene CTD PMID:33148267 Rgs6 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of RGS6 mRNA CTD PMID:20360939 Rgs6 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RGS6 mRNA CTD PMID:28374803 Rgs6 Rat sodium arsenite affects methylation ISO RGS6 (Homo sapiens) 6480464 sodium arsenite affects the methylation of RGS6 gene CTD PMID:28589171 Rgs6 Rat sodium arsenite increases expression ISO Rgs6 (Mus musculus) 6480464 sodium arsenite results in increased expression of RGS6 mRNA CTD PMID:37682722 Rgs6 Rat sunitinib decreases expression ISO RGS6 (Homo sapiens) 6480464 Sunitinib results in decreased expression of RGS6 mRNA CTD PMID:31533062 Rgs6 Rat titanium dioxide decreases methylation ISO Rgs6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RGS6 gene CTD PMID:35295148 Rgs6 Rat titanium dioxide increases methylation ISO Rgs6 (Mus musculus) 6480464 titanium dioxide results in increased methylation of RGS6 gene CTD PMID:35295148 Rgs6 Rat triclosan decreases expression ISO RGS6 (Homo sapiens) 6480464 Triclosan results in decreased expression of RGS6 mRNA CTD PMID:30510588 Rgs6 Rat triphenyl phosphate affects expression ISO RGS6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RGS6 mRNA CTD PMID:37042841 Rgs6 Rat zidovudine multiple interactions ISO RGS6 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of RGS6 mRNA CTD PMID:20370541
1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amiodarone (ISO) ammonium chloride (EXP) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) Cuprizon (EXP) doxorubicin (ISO) fulvestrant (ISO) genistein (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) permethrin (EXP) phenethyl caffeate (EXP) rotenone (EXP) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) triclosan (ISO) triphenyl phosphate (ISO) zidovudine (ISO)
1.
An association study revealed substantial effects of dominance, epistasis and substance dependence co-morbidity on alcohol dependence symptom count.
Chen G, etal., Addict Biol. 2017 Nov;22(6):1475-1485. doi: 10.1111/adb.12402. Epub 2016 May 5.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Regulators of G-protein signaling (RGS) proteins: region-specific expression of nine subtypes in rat brain.
Gold SJ, etal., J Neurosci 1997 Oct 15;17(20):8024-37.
5.
EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.
Koelle MR and Horvitz HR, Cell 1996 Jan 12;84(1):115-25.
6.
RGS6 interacts with SCG10 and promotes neuronal differentiation. Role of the G gamma subunit-like (GGL) domain of RGS6.
Liu Z, etal., J Biol Chem 2002 Oct 4;277(40):37832-9. Epub 2002 Jul 24.
7.
Expression of neural RGS-R7 and Gbeta5 Proteins in Response to Acute and Chronic Morphine.
López-Fando A, etal., Neuropsychopharmacology. 2005 Jan;30(1):99-110. doi: 10.1038/sj.npp.1300515.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
RGS Proteins in Heart: Brakes on the Vagus.
Stewart A, etal., Front Physiol. 2012 Apr 13;3:95. doi: 10.3389/fphys.2012.00095. eCollection 2012.
Rgs6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 107,875,883 - 108,527,472 (+) NCBI GRCr8 mRatBN7.2 6 102,264,451 - 102,796,311 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 102,264,447 - 102,824,753 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 102,420,755 - 102,953,980 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 102,719,975 - 103,253,217 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 102,089,444 - 102,622,685 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 106,310,442 - 106,598,668 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 106,496,992 - 106,602,139 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 114,636,387 - 114,736,790 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 106,470,420 - 106,964,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 106,940,142 - 106,967,896 (+) NCBI Celera 6 100,100,895 - 100,625,650 (+) NCBI Celera Cytogenetic Map 6 q24-q31 NCBI
RGS6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 71,867,335 - 72,630,029 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 71,932,429 - 72,566,530 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 72,398,888 - 73,033,238 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 71,469,539 - 72,102,991 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 71,469,585 - 72,100,407 NCBI Celera 14 52,462,976 - 53,096,417 (+) NCBI Celera Cytogenetic Map 14 q24.2 NCBI HuRef 14 52,565,478 - 53,199,765 (+) NCBI HuRef CHM1_1 14 72,336,952 - 72,971,253 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 66,072,765 - 66,835,660 (+) NCBI T2T-CHM13v2.0
Rgs6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 82,663,325 - 83,208,835 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 82,635,066 - 83,208,830 (+) Ensembl GRCm39 Ensembl GRCm38 12 82,616,551 - 83,162,061 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 82,588,292 - 83,162,056 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 83,718,025 - 84,259,799 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 83,535,886 - 84,077,669 (+) NCBI MGSCv36 mm8 Celera 12 84,069,722 - 84,604,177 (+) NCBI Celera Cytogenetic Map 12 D1 NCBI cM Map 12 38.14 NCBI
Rgs6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955523 2,762,987 - 3,335,474 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955523 2,763,143 - 3,366,851 (-) NCBI ChiLan1.0 ChiLan1.0
RGS6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 73,042,379 - 73,677,406 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 72,258,892 - 72,893,920 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 52,511,846 - 53,146,872 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 71,377,567 - 72,012,766 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 71,409,701 - 72,008,988 (+) Ensembl panpan1.1 panPan2
RGS6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 45,392,246 - 45,975,073 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 45,438,239 - 46,009,049 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 45,077,684 - 45,656,669 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 45,630,187 - 46,197,033 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 45,654,256 - 46,194,458 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 45,301,232 - 45,866,115 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 45,329,999 - 45,882,332 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 45,692,998 - 46,272,644 (+) NCBI UU_Cfam_GSD_1.0
Rgs6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 30,144,323 - 30,732,878 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 1,361,310 - 1,921,353 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 1,336,075 - 1,924,635 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RGS6
RGS6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 49,161,466 - 49,803,209 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 49,591,815 - 49,775,653 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 37,367,918 - 37,991,218 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rgs6
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 56 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000058181 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH140792
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 102,792,686 - 102,792,927 (+) MAPPER mRatBN7.2 Rnor_6.0 6 106,598,200 - 106,598,440 NCBI Rnor6.0 Rnor_5.0 6 114,736,322 - 114,736,562 UniSTS Rnor5.0 RGSC_v3.4 6 106,987,770 - 106,988,010 UniSTS RGSC3.4 Celera 6 100,625,182 - 100,625,422 UniSTS RH 3.4 Map 6 732.5 UniSTS Cytogenetic Map 6 q24 UniSTS
RH143195
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 102,792,822 - 102,793,075 (+) MAPPER mRatBN7.2 Rnor_6.0 6 106,598,336 - 106,598,588 NCBI Rnor6.0 Rnor_5.0 6 114,736,458 - 114,736,710 UniSTS Rnor5.0 RGSC_v3.4 6 106,987,906 - 106,988,158 UniSTS RGSC3.4 Celera 6 100,625,318 - 100,625,570 UniSTS RH 3.4 Map 6 738.0 UniSTS Cytogenetic Map 6 q24 UniSTS
RH143409
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 108,423,622 - 108,423,874 (+) Marker Load Pipeline mRatBN7.2 6 102,692,460 - 102,692,712 (+) MAPPER mRatBN7.2 Rnor_6.0 6 106,499,816 - 106,500,067 NCBI Rnor6.0 Rnor_5.0 6 114,639,079 - 114,639,330 UniSTS Rnor5.0 RGSC_v3.4 6 106,876,517 - 106,876,768 UniSTS RGSC3.4 Celera 6 100,526,473 - 100,526,724 UniSTS RH 3.4 Map 6 738.0 UniSTS Cytogenetic Map 6 q24 UniSTS
BF398997
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 102,773,210 - 102,773,402 (+) MAPPER mRatBN7.2 Rnor_6.0 6 106,578,724 - 106,578,915 NCBI Rnor6.0 Rnor_5.0 6 114,716,846 - 114,717,037 UniSTS Rnor5.0 RGSC_v3.4 6 106,968,294 - 106,968,485 UniSTS RGSC3.4 Celera 6 100,605,596 - 100,605,787 UniSTS RH 3.4 Map 6 738.0 UniSTS Cytogenetic Map 6 q24 UniSTS
fc10a03.x1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 102,616,986 - 102,618,290 (+) MAPPER mRatBN7.2 Rnor_6.0 6 107,944,860 - 107,946,163 NCBI Rnor6.0 Rnor_5.0 6 117,600,272 - 117,601,576 NCBI Rnor5.0 RGSC_v3.4 6 106,800,999 - 106,802,302 UniSTS RGSC3.4 Celera 6 100,451,085 - 100,452,388 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058181 ⟹ ENSRNOP00000054984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,793,155 (+) Ensembl Rnor_6.0 Ensembl 6 106,497,125 - 106,598,668 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086136 ⟹ ENSRNOP00000069089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,693,478 - 102,773,706 (+) Ensembl Rnor_6.0 Ensembl 6 106,496,992 - 106,602,139 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095987 ⟹ ENSRNOP00000082201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,631 - 102,824,753 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100420 ⟹ ENSRNOP00000077898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,733,221 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103061 ⟹ ENSRNOP00000079796
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,689,770 - 102,770,177 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107970 ⟹ ENSRNOP00000091378
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,773,304 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109319 ⟹ ENSRNOP00000079945
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,793,132 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112595 ⟹ ENSRNOP00000092991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,793,132 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113156 ⟹ ENSRNOP00000091512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,793,132 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114544 ⟹ ENSRNOP00000085795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 102,264,447 - 102,824,753 (+) Ensembl
RefSeq Acc Id:
NM_019342 ⟹ NP_062215
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,996,495 - 108,524,316 (+) NCBI mRatBN7.2 6 102,265,295 - 102,793,155 (+) NCBI Rnor_6.0 6 106,310,442 - 106,598,668 (+) NCBI Rnor_5.0 6 114,636,387 - 114,736,790 (+) NCBI Celera 6 100,100,895 - 100,625,650 (+) NCBI
Sequence:
ATTTCAGATGCGTGACAGGTGCGGGTGTGTGTCTGCAGTTTGGGACTGTGCACGGCGAGCTTACTGTGGGAGAAGACACTCAGGATGGCTCAGGGATCCGGAGACCAGCGAGCAGTGGGGGTTGCTGA
hide sequence
RefSeq Acc Id:
XM_039112783 ⟹ XP_038968711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,996,666 - 108,527,472 (+) NCBI mRatBN7.2 6 102,265,483 - 102,796,311 (+) NCBI
RefSeq Acc Id:
XM_039112784 ⟹ XP_038968712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,996,881 - 108,527,472 (+) NCBI mRatBN7.2 6 102,265,679 - 102,796,311 (+) NCBI
RefSeq Acc Id:
XM_039112785 ⟹ XP_038968713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,996,460 - 108,527,472 (+) NCBI mRatBN7.2 6 102,265,264 - 102,796,311 (+) NCBI
RefSeq Acc Id:
XM_039112787 ⟹ XP_038968715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,504,530 (+) NCBI mRatBN7.2 6 102,293,910 - 102,777,665 (+) NCBI
RefSeq Acc Id:
XM_039112789 ⟹ XP_038968717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,523,530 (+) NCBI mRatBN7.2 6 102,293,910 - 102,792,406 (+) NCBI
RefSeq Acc Id:
XM_039112790 ⟹ XP_038968718
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,488,421 (+) NCBI mRatBN7.2 6 102,293,910 - 102,759,765 (+) NCBI
RefSeq Acc Id:
XM_063262367 ⟹ XP_063118437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,527,472 (+) NCBI
RefSeq Acc Id:
XM_063262368 ⟹ XP_063118438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,527,472 (+) NCBI
RefSeq Acc Id:
XM_063262369 ⟹ XP_063118439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,527,472 (+) NCBI
RefSeq Acc Id:
XM_063262370 ⟹ XP_063118440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,996,608 - 108,527,472 (+) NCBI
RefSeq Acc Id:
XR_005505572
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 107,875,883 - 108,523,504 (+) NCBI mRatBN7.2 6 102,293,910 - 102,792,343 (+) NCBI
RefSeq Acc Id:
NP_062215 ⟸ NM_019342
- UniProtKB:
F1LS67 (UniProtKB/TrEMBL), A0A8I6GJP9 (UniProtKB/TrEMBL)
- Sequence:
MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYVFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPEN
hide sequence
Ensembl Acc Id:
ENSRNOP00000054984 ⟸ ENSRNOT00000058181
Ensembl Acc Id:
ENSRNOP00000069089 ⟸ ENSRNOT00000086136
RefSeq Acc Id:
XP_038968713 ⟸ XM_039112785
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G3X7 (UniProtKB/TrEMBL), A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968711 ⟸ XM_039112783
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G3X7 (UniProtKB/TrEMBL), A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968712 ⟸ XM_039112784
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G3X7 (UniProtKB/TrEMBL), A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968717 ⟸ XM_039112789
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968715 ⟸ XM_039112787
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GJK3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968718 ⟸ XM_039112790
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6GJP9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000079796 ⟸ ENSRNOT00000103061
Ensembl Acc Id:
ENSRNOP00000079945 ⟸ ENSRNOT00000109319
Ensembl Acc Id:
ENSRNOP00000091512 ⟸ ENSRNOT00000113156
Ensembl Acc Id:
ENSRNOP00000092991 ⟸ ENSRNOT00000112595
Ensembl Acc Id:
ENSRNOP00000091378 ⟸ ENSRNOT00000107970
Ensembl Acc Id:
ENSRNOP00000085795 ⟸ ENSRNOT00000114544
Ensembl Acc Id:
ENSRNOP00000077898 ⟸ ENSRNOT00000100420
Ensembl Acc Id:
ENSRNOP00000082201 ⟸ ENSRNOT00000095987
RefSeq Acc Id:
XP_063118437 ⟸ XM_063262367
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118438 ⟸ XM_063262368
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118439 ⟸ XM_063262369
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6GJP9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118440 ⟸ XM_063262370
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G3X7 (UniProtKB/TrEMBL), A0A8I6GJP9 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Rgs6
regulator of G-protein signaling 6
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_physical_interaction
human homolog binds neuronal growth associated protein SCG10
737642
