Advanced Search (OLGA)

Gene: Rbbp9 (RB binding protein 9, serine hydrolase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rbbp9

Name:

RB binding protein 9, serine hydrolase

RGD ID:

3542

Description:

Predicted to enable hydrolase activity. Involved in regulation of cell population proliferation. Predicted to be located in nucleoplasm. Orthologous to human RBBP9 (RB binding protein 9, serine hydrolase); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B5T overexpressed gene protein; B5T-overexpressed gene protein; MGC124617; putative hydrolase RBBP9; RBBP-9; retinoblastoma binding protein 9; retinoblastoma-binding protein 9; serine hydrolase RBBP9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	152,378,426 - 152,392,370 (-)	NCBI		GRCr8
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	135,854,833 - 135,861,526 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	144,438,915 - 144,445,608 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	142,142,123 - 142,148,816 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	132,996,734 - 133,003,483 (-)	NCBI
Celera	3	130,819,354 - 130,826,133 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbbp9	Rat	congenital dyserythropoietic anemia type II		ISO	RBBP9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital dyserythropoietic anemia and type II	ClinVar	PMID:19561605 more ...
Rbbp9	Rat	familial hyperinsulinemic hypoglycemia 1		ISO	RBBP9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hyperinsulinemic hypoglycemia more ...	ClinVar	PMID:38605124

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbbp9	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of RBBP9 mRNA]	CTD	PMID:31150632
Rbbp9	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RBBP9 mRNA	CTD	PMID:36331819
Rbbp9	Rat	(S)-nicotine	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	Nicotine results in increased expression of RBBP9 mRNA	CTD	PMID:17997037
Rbbp9	Rat	1,2-dimethylhydrazine	affects expression	ISO	Rbbp9 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of RBBP9 mRNA	CTD	PMID:22206623
Rbbp9	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Rbbp9 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of RBBP9 mRNA	CTD	PMID:21570461
Rbbp9	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of RBBP9 mRNA	CTD	PMID:32109520
Rbbp9	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of RBBP9 mRNA	CTD	PMID:30851411
Rbbp9	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3 more ...	CTD	PMID:23196670
Rbbp9	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of RBBP9 mRNA	CTD	PMID:18648102
Rbbp9	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of RBBP9 mRNA	CTD	PMID:30047161
Rbbp9	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of RBBP9 mRNA	CTD	PMID:28959563
Rbbp9	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of RBBP9 mRNA	CTD	PMID:30047161
Rbbp9	Rat	Aroclor 1254	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of RBBP9 mRNA	CTD	PMID:23650126
Rbbp9	Rat	arsane	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	arsenic atom	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	atrazine	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Atrazine results in decreased expression of RBBP9 mRNA	CTD	PMID:22378314
Rbbp9	Rat	benzo[a]pyrene	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of RBBP9 mRNA	CTD	PMID:22316170
Rbbp9	Rat	benzo[a]pyrene	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of RBBP9 mRNA	CTD	PMID:22228805
Rbbp9	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RBBP9 mRNA	CTD	PMID:30816183 more ...
Rbbp9	Rat	bisphenol A	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	bisphenol A results in decreased expression of RBBP9 mRNA	CTD	PMID:33221593
Rbbp9	Rat	bisphenol AF	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	bisphenol AF results in increased expression of RBBP9 protein	CTD	PMID:34186270
Rbbp9	Rat	Bisphenol B	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	bisphenol B results in increased expression of RBBP9 protein	CTD	PMID:34186270
Rbbp9	Rat	bisphenol F	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	bisphenol F results in increased expression of RBBP9 mRNA	CTD	PMID:38685157
Rbbp9	Rat	bisphenol F	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	bisphenol F results in increased expression of RBBP9 protein	CTD	PMID:34186270
Rbbp9	Rat	cadmium atom	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of RBBP9 mRNA	CTD	PMID:35301059
Rbbp9	Rat	cadmium atom	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBBP9 mRNA	CTD	PMID:37325564
Rbbp9	Rat	cadmium dichloride	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of RBBP9 mRNA	CTD	PMID:35301059
Rbbp9	Rat	cadmium dichloride	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RBBP9 mRNA	CTD	PMID:37325564
Rbbp9	Rat	cisplatin	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of RBBP9 mRNA	CTD	PMID:27392435
Rbbp9	Rat	copper atom	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of RBBP9 mRNA	CTD	PMID:20971185
Rbbp9	Rat	copper(0)	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of RBBP9 mRNA	CTD	PMID:20971185
Rbbp9	Rat	copper(II) sulfate	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of RBBP9 mRNA	CTD	PMID:19549813
Rbbp9	Rat	coumestrol	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RBBP9 mRNA	CTD	PMID:19167446
Rbbp9	Rat	coumestrol	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	Coumestrol results in increased expression of RBBP9 mRNA	CTD	PMID:19167446
Rbbp9	Rat	cyclosporin A	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of RBBP9 mRNA	CTD	PMID:25562108
Rbbp9	Rat	dioxygen	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of RBBP9 mRNA	CTD	PMID:30529165
Rbbp9	Rat	disodium selenite	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of RBBP9 mRNA	CTD	PMID:18175754
Rbbp9	Rat	diuron	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Diuron results in decreased expression of RBBP9 mRNA	CTD	PMID:35967413
Rbbp9	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of RBBP9 mRNA	CTD	PMID:29391264
Rbbp9	Rat	Enterolactone	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RBBP9 mRNA	CTD	PMID:19167446
Rbbp9	Rat	epoxiconazole	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	epoxiconazole results in decreased expression of RBBP9 mRNA	CTD	PMID:35436446
Rbbp9	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of RBBP9 mRNA	CTD	PMID:30307764
Rbbp9	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of RBBP9 mRNA	CTD	PMID:24136188
Rbbp9	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of RBBP9 mRNA	CTD	PMID:33387578
Rbbp9	Rat	ivermectin	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Ivermectin results in decreased expression of RBBP9 protein	CTD	PMID:32959892
Rbbp9	Rat	manganese atom	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	manganese(0)	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	manganese(II) chloride	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of RBBP9 mRNA	CTD	PMID:30467583
Rbbp9	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of RBBP9 mRNA	CTD	PMID:30047161
Rbbp9	Rat	methylparaben	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	methylparaben results in decreased expression of RBBP9 mRNA	CTD	PMID:31745603
Rbbp9	Rat	N-nitrosodiethylamine	decreases expression	EXP		6480464	Diethylnitrosamine results in decreased expression of RBBP9 mRNA	CTD	PMID:20360939
Rbbp9	Rat	nickel sulfate	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	nickel sulfate results in decreased expression of RBBP9 mRNA	CTD	PMID:22714537
Rbbp9	Rat	nicotine	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	Nicotine results in increased expression of RBBP9 mRNA	CTD	PMID:17997037
Rbbp9	Rat	paclitaxel	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Paclitaxel results in decreased expression of RBBP9 mRNA	CTD	PMID:15000894
Rbbp9	Rat	paracetamol	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of RBBP9 mRNA	CTD	PMID:21420995 and PMID:26690555
Rbbp9	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RBBP9 mRNA	CTD	PMID:33387578
Rbbp9	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RBBP9 mRNA	CTD	PMID:36331819
Rbbp9	Rat	phenobarbital	affects expression	ISO	Rbbp9 (Mus musculus)	6480464	Phenobarbital affects the expression of RBBP9 mRNA	CTD	PMID:23091169
Rbbp9	Rat	phenobarbital	decreases expression	EXP		6480464	Phenobarbital results in decreased expression of RBBP9 mRNA	CTD	PMID:30047161
Rbbp9	Rat	pirinixic acid	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	pirinixic acid results in decreased expression of RBBP9 mRNA	CTD	PMID:18445702
Rbbp9	Rat	pyrogallol	increases expression	ISO	Rbbp9 (Mus musculus)	6480464	Pyrogallol results in increased expression of RBBP9 mRNA	CTD	PMID:20362636
Rbbp9	Rat	rac-lactic acid	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of RBBP9 mRNA	CTD	PMID:30851411
Rbbp9	Rat	resveratrol	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of RBBP9 mRNA	CTD	PMID:23557933
Rbbp9	Rat	sodium arsenite	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of RBBP9 mRNA	CTD	PMID:22714537 and PMID:38568856
Rbbp9	Rat	sodium arsenite	multiple interactions	ISO	RBBP9 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBBP9 mRNA	CTD	PMID:39836092
Rbbp9	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of RBBP9 mRNA	CTD	PMID:30047161
Rbbp9	Rat	sulforaphane	multiple interactions	ISO	Rbbp9 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of RBBP9 mRNA	CTD	PMID:30529165
Rbbp9	Rat	sunitinib	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Sunitinib results in decreased expression of RBBP9 mRNA	CTD	PMID:31533062
Rbbp9	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of RBBP9 mRNA]	CTD	PMID:31150632
Rbbp9	Rat	tetrachloromethane	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of RBBP9 mRNA	CTD	PMID:31919559
Rbbp9	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of RBBP9 mRNA	CTD	PMID:30690589 and PMID:31150632
Rbbp9	Rat	tetrachloromethane	increases methylation	EXP		6480464	Carbon Tetrachloride results in increased methylation of RBBP9 promoter	CTD	PMID:30690589
Rbbp9	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of RBBP9 mRNA	CTD	PMID:34492290
Rbbp9	Rat	thiram	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Thiram results in decreased expression of RBBP9 mRNA	CTD	PMID:38568856
Rbbp9	Rat	torcetrapib	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	torcetrapib results in increased expression of RBBP9 mRNA	CTD	PMID:23228038
Rbbp9	Rat	trimellitic anhydride	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	trimellitic anhydride results in decreased expression of RBBP9 mRNA	CTD	PMID:19042947
Rbbp9	Rat	triphenyl phosphate	affects expression	ISO	RBBP9 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of RBBP9 mRNA	CTD	PMID:37042841
Rbbp9	Rat	urethane	decreases expression	ISO	RBBP9 (Homo sapiens)	6480464	Urethane results in decreased expression of RBBP9 mRNA	CTD	PMID:28818685
Rbbp9	Rat	valproic acid	decreases expression	ISO	Rbbp9 (Mus musculus)	6480464	Valproic Acid results in decreased expression of RBBP9 mRNA	CTD	PMID:21427059
Rbbp9	Rat	valproic acid	affects expression	ISO	RBBP9 (Homo sapiens)	6480464	Valproic Acid affects the expression of RBBP9 mRNA	CTD	PMID:25979313
Rbbp9	Rat	zoledronic acid	increases expression	ISO	RBBP9 (Homo sapiens)	6480464	zoledronic acid results in increased expression of RBBP9 mRNA	CTD	PMID:20977926

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbbp9	Rat	positive regulation of gene expression	acts_upstream_of_or_within	ISO	Rbbp9 (Mus musculus)	1624291	PMID:32484881	RGD	PMID:32484881
Rbbp9	Rat	positive regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:O88851 and ensembl:ENSMUSP00000028915	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbbp9	Rat	regulation of cell population proliferation		IMP		69955		RGD
Rbbp9	Rat	response to nematode	acts_upstream_of_or_within	IEA	UniProtKB:O88851 and ensembl:ENSMUSP00000028915	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbbp9	Rat	response to nematode	acts_upstream_of_or_within	ISO	Rbbp9 (Mus musculus)	1624291	MGI:6506180 PMID:32484881	RGD	PMID:32484881
Rbbp9	Rat	type II pneumocyte differentiation	acts_upstream_of_or_within	IEA	UniProtKB:O88851 and ensembl:ENSMUSP00000028915	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbbp9	Rat	type II pneumocyte differentiation	acts_upstream_of_or_within	ISO	Rbbp9 (Mus musculus)	1624291	PMID:32484881	RGD	PMID:32484881
Rbbp9	Rat	xenobiotic metabolic process	involved_in	ISO	RBBP9 (Homo sapiens)	1624291	PMID:32196348	RGD	PMID:32196348

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbbp9	Rat	nucleoplasm	located_in	IEA	UniProtKB:O75884 and ensembl:ENSP00000336866	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbbp9	Rat	nucleoplasm	located_in	ISO	RBBP9 (Homo sapiens) and UniProtKB:O75884-1	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbbp9	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rbbp9	Rat	hydrolase activity	enables	IEA	InterPro:IPR010662	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rbbp9	Rat	protein binding		IPI	Rb1 (Rattus norvegicus)	69955		RGD
Rbbp9	Rat	protein binding	enables	ISO	RBBP9 (Homo sapiens)	1624291	UniProtKB:O95199 more ...	RGD	PMID:21044950 and PMID:32296183
Rbbp9	Rat	protein binding	enables	IPI	UniProtKB:P33568	69955	PMID:9697699	IntAct
Rbbp9	Rat	serine hydrolase activity	enables	ISS	UniProtKB:O75884	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Rbbp9	Rat	serine hydrolase activity	enables	IEA	UniProtKB:O75884 and ensembl:ENSP00000336866	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbbp9	Rat	serine hydrolase activity	enables	ISO	RBBP9 (Homo sapiens)	1624291	PMID:19329999 more ...	RGD	PMID:19329999 more ...

#	Reference Title	Reference Citation
1.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	A retinoblastoma-binding protein that affects cell-cycle control and confers transforming ability.	Woitach JT, etal., Nat Genet 1998 Aug;19(4):371-4.

PMID:12477932	PMID:23376485

Rbbp9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	152,378,426 - 152,392,370 (-)	NCBI		GRCr8
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	135,854,833 - 135,861,526 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	144,438,915 - 144,445,608 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	142,142,123 - 142,148,816 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	132,996,734 - 133,003,483 (-)	NCBI
Celera	3	130,819,354 - 130,826,133 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

RBBP9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	18,486,540 - 18,497,225 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	18,486,540 - 18,497,225 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	18,467,184 - 18,477,869 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	18,415,184 - 18,425,887 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	18,415,189 - 18,425,887	NCBI
Celera	20	18,541,234 - 18,551,942 (-)	NCBI		Celera
Cytogenetic Map	20	p11.23	NCBI
HuRef	20	18,429,215 - 18,439,909 (-)	NCBI		HuRef
CHM1_1	20	18,467,190 - 18,477,891 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	18,537,660 - 18,548,351 (-)	NCBI		T2T-CHM13v2.0

Rbbp9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	144,384,185 - 144,392,779 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	144,384,185 - 144,392,789 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	144,542,265 - 144,550,859 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	144,542,265 - 144,550,869 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	144,368,001 - 144,376,595 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	144,233,706 - 144,242,300 (-)	NCBI		MGSCv36	mm8
MGSCv36	2	145,595,875 - 145,604,246 (-)	NCBI		MGSCv36	mm8
Celera	2	145,728,377 - 145,736,792 (-)	NCBI		Celera
Cytogenetic Map	2	G1	NCBI
cM Map	2	71.02	NCBI

Rbbp9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	27,033,658 - 27,044,558 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	27,037,875 - 27,044,558 (-)	NCBI	ChiLan1.0	ChiLan1.0

RBBP9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	19,379,446 - 19,389,295 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	19,376,285 - 19,386,132 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	18,451,015 - 18,459,231 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	18,422,645 - 18,430,170 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	18,422,652 - 18,430,170 (-)	Ensembl	panpan1.1		panPan2

RBBP9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	4,704,957 - 4,712,644 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	4,704,362 - 4,710,798 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	4,635,528 - 4,643,633 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	5,112,474 - 5,120,576 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	5,112,440 - 5,120,570 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	4,712,327 - 4,720,421 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	4,816,933 - 4,825,030 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	5,095,537 - 5,103,633 (+)	NCBI		UU_Cfam_GSD_1.0

Rbbp9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	153,355,664 - 153,366,992 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	1,787,028 - 1,798,277 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	1,787,048 - 1,796,233 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBBP9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	26,736,526 - 26,760,242 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	26,740,559 - 26,749,698 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	30,230,145 - 30,239,276 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBBP9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	47,549,090 - 47,559,459 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	47,552,024 - 47,559,365 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	2,282,476 - 2,292,825 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbbp9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	19,214,536 - 19,222,530 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	19,214,436 - 19,222,511 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rbbp9
40 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	188
Interacting mature miRNAs:	215
Transcripts:	ENSRNOT00000010678
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

BF386174

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	131,930,904 - 131,931,056 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	138,707,123 - 138,707,274	NCBI	Rnor6.0
Rnor_5.0	3	145,137,037 - 145,137,188	UniSTS	Rnor5.0
RGSC_v3.4	3	133,096,701 - 133,096,852	UniSTS	RGSC3.4
Celera	3	130,824,924 - 130,825,075	UniSTS
RH 3.4 Map	3	1181.2	UniSTS
Cytogenetic Map	3	q41	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_019219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF025819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010678 ⟹ ENSRNOP00000010678

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl

RefSeq Acc Id:

NM_019219 ⟹ NP_062092

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	152,378,692 - 152,385,445 (-)	NCBI
mRatBN7.2	3	131,925,361 - 131,932,114 (-)	NCBI
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	RGD
Celera	3	130,819,354 - 130,826,133 (-)	RGD

Sequence:

show sequence

GTCTCACGTCTGCATTAATGGCGTCCCCTACCAAGGCAGTGATTGTTCCTGGGAACGGAGGCGGGGATGTGGCCACCCACGGCTGGTACGGCTGGGTGAGAAAGGGGCTGGAGCAGATTCCTGGTTTC
CAGTGTTTGGCTAAAAACATGCCTGACCCAATTACCGCTCGAGAGAGCATCTGGCTGCCCTTCATGGAGACAGAACTGCACTGTGATGAGAAGACCATCATCATAGGCCACAGTTCCGGGGCCATCGC
AGCCATGAGGTATGCAGAGACACATCAGGTATACGCTCTCATATTGGTGTCTGCATACACATCAGACTTGGGAGATGAAAATGAGCGTGCAAGTGGGTACTTCAGCCGCCCCTGGCAGTGGGAGAAGA
TCAAGGCCAACTGCCCTCACATTATACAGTTTGGCTCTACTGATGACCCCTTCCTTCCATGGAAGGAACAACAAGAAGTGGCAGATAGGCTGGACGCCAAACTGTACAAATTCACTGACCGTGGTCAC
TTTCAGAACACAGAGTTCCATGAACTGATTAGAGTGGTGAAGTCTATGCTGACTCCTGCTCTGTAACACGCCAGGATGGGGTAGAAGAGTAACAGCCGCTACCCTCACACAGCTTAGACATGGACGTC
CGTCCAGTTAGACTACAGAAGTGTCTGAGCAACAAACCCATTTGAACACTCACACTGAGTTAGTAGCACTTCCAGTTCCCACAGAGCTTAAATCTCCCCAAAAGCTACTAGCTACAGCAGTATGTTTC
CTGTTTGATAAGAGACAGGTTTTTTATTTTTAAGCTATCCTGTTGATGCAAAGAGAGTTAAGTCAGAAGAATCCAGAACTTGACATAGACCTGGTTGTGTGTCCCTGTAATCATTTCAGAAAGCAGGG
TCAGGAGGGAAGGCTATCTTGACCCTGTCTCAGAAAGAGTGAGCAAGAAGATGACCCAGGTCTCCTGAGGCTCATTCCAAATTATAACTCACTATGTTTAGCAAGATGTGTTCCACTTCTGAGACCCC
AGTACTTGGAAAACTGAGGAAGGTTCATCTTGAGTTTGAGACCTTGTCTAGGCTAAGTAAACCCTGTCTCAAAACAACAACAAAAACAGGTTTTCATTCAACTTATATGACTGACACTTTCCATTTGT
AATAAAAAATTTTCTCTTACTGGGGAAATGAAAACACGATTCAAGGTCCAGAATGTTGTCTTAGAACTCAAAACTCTGGTTGCTCTTTAAAACTGGCTCAAGAGAATAAACTCAAACTTGGGTGTTCA
TCATTGAAATTCCTGACCCCACCACGTCCCCAACCGTCCAGACTCTACAGTGAGAGTGACACATATGATGCTAGTAGACTGCAGGCAGTATCTGTTATACACTGTATAGACTGCAGATTCGATCATGG
GAGTGCTGCAATATAGAAATGTGACCTATGTCTTTTTTACTAGAGAATATAGTGTGTATATAATTCCTACATGAATTATGGTAACTGGGAACAGCATTGTAATTAAAAGATTTGCAAATGCTACTACA
AGACAAAGACCAGGTCATCCCTTTGTGAACTTGGTCGTAAACATTTTTAGAATCTCTATGAAGTCCAAGAAAAACAAGATAACTAAAATGACATAATACTAAAGGGTGGAAAACAAGGAGCAATCGTA
TTTTGTTATTAAGTTTTTAAGTATCTTCAAAAGAACTTTTCCAGGGCTAGGGAGAAGGCTGACAGTCAAGAGGCTACTGAGTTTTTTTCCAGAGTTCTGAGTTCAATTCCCAGCAACTACATGGTAGT
CACAACCATCTGTAATGGACCCGATGCCCTCTTCTGGTGTGTCTGAAGACAGCTACAGTGTACTCACATACATAAAATAAGTAAATCTTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104444 ⟹ XP_038960372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	152,378,426 - 152,392,370 (-)	NCBI
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI

RefSeq Acc Id:

XM_039104445 ⟹ XP_038960373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	152,378,426 - 152,385,480 (-)	NCBI
mRatBN7.2	3	131,925,095 - 131,932,146 (-)	NCBI

RefSeq Acc Id:

XM_063283215 ⟹ XP_063139285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	152,378,426 - 152,392,320 (-)	NCBI


Protein RefSeqs	NP_062092	(Get FASTA)	NCBI Sequence Viewer
	XP_038960372	(Get FASTA)	NCBI Sequence Viewer
	XP_038960373	(Get FASTA)	NCBI Sequence Viewer
	XP_063139285	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC40205	(Get FASTA)	NCBI Sequence Viewer
	AAI01916	(Get FASTA)	NCBI Sequence Viewer
	EDL95156	(Get FASTA)	NCBI Sequence Viewer
	EDL95157	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010678
GenBank Protein	O88350	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062092 ⟸ NM_019219
- UniProtKB:	Q3T1H7 (UniProtKB/Swiss-Prot), O88350 (UniProtKB/Swiss-Prot), A6K763 (UniProtKB/TrEMBL), A0A8L2Q4I8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASPTKAVIVPGNGGGDVATHGWYGWVRKGLEQIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTIIIGHSSGAIAAMRYAETHQVYALILVSAYTSDLGDENERASGYFSRPWQWEKIKANCP HIIQFGSTDDPFLPWKEQQEVADRLDAKLYKFTDRGHFQNTEFHELIRVVKSMLTPAL hide sequence

Ensembl Acc Id:

ENSRNOP00000010678 ⟸ ENSRNOT00000010678

RefSeq Acc Id:	XP_038960372 ⟸ XM_039104444
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960373 ⟸ XM_039104445
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063139285 ⟸ XM_063283215
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88350-F1-model_v2	AlphaFold	O88350	1-186	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692484

Promoter ID:

EPDNEW_R3009

Type:

initiation region

Name:

Rbbp9_1

Description:

RB binding protein 9, serine hydrolase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	138,708,356 - 138,708,416	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-47597	BioCyc
Ensembl Genes	ENSRNOG00000007972	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000010678	ENTREZGENE
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7935765	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	Hydrolase_RBBP9/YdeN	UniProtKB/Swiss-Prot
	RBBP9	UniProtKB/Swiss-Prot
KEGG Report	rno:29459	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124617	IMAGE-MGC_LOAD
NCBI Gene	29459	ENTREZGENE
PANTHER	SERINE HYDROLASE RBBP9	UniProtKB/Swiss-Prot
	SERINE HYDROLASE RBBP9	UniProtKB/Swiss-Prot
Pfam	Ser_hydrolase	UniProtKB/Swiss-Prot
PhenoGen	Rbbp9	PhenoGen
RatGTEx	ENSRNOG00000007972	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	A0A8L2Q4I8	ENTREZGENE, UniProtKB/TrEMBL
	A6K762_RAT	UniProtKB/TrEMBL
	A6K763	ENTREZGENE, UniProtKB/TrEMBL
	O88350	ENTREZGENE
	Q3T1H7	ENTREZGENE
	RBBP9_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q3T1H7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-03	Rbbp9	RB binding protein 9, serine hydrolase	Rbbp9	retinoblastoma binding protein 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Rbbp9	retinoblastoma binding protein 9		retinoblastoma-binding protein 9	Name updated	1299863	APPROVED
2002-06-10	Rbbp9	retinoblastoma-binding protein 9			Name updated	70584	APPROVED

Note Type	Note	Reference
gene_mutations_overexpression	overexpression confers resistance to TGF-beta1 mediated growth inhibition in liver epithelial cells	69955
gene_physical_interaction	binds retinoblastoma (Rb), can displace E2F from E2F-1 complexed with Rb in vitro	69955

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar