Symbol:
Klk6
Name:
kallikrein related-peptidase 6
RGD ID:
3419
Description:
Enables peptidase activity. Involved in regulation of neuron projection development. Predicted to be located in several cellular components, including extracellular region; intercellular bridge; and nucleus. Predicted to be active in cornified envelope; extracellular space; and secretory granule. Human ortholog(s) of this gene implicated in Alzheimer's disease; Lewy body dementia; Parkinson's disease; demyelinating disease; and multiple system atrophy. Orthologous to human KLK6 (kallikrein related peptidase 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
kallikrein 6; kallikrein 6 (neurosin zyme); kallikrein 6 (neurosin); kallikrein 6 (neurosin, zyme); kallikrein i; kallikrein-6; Klni; protease serine 9; protease serine 9 (neurosin); protease, serine, 9; Prss9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 103,415,411 - 103,422,682 (+) NCBI GRCr8 mRatBN7.2 1 94,278,863 - 94,286,136 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 94,280,340 - 94,286,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,664,377 - 99,671,533 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,137,048 - 108,144,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 101,426,648 - 101,433,802 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 99,762,195 - 99,769,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 99,762,253 - 99,769,488 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 100,830,974 - 100,838,254 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 94,254,350 - 94,261,500 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 94,332,460 - 94,339,610 (+) NCBI Celera 1 88,546,437 - 88,553,549 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klk6 Rat 17beta-estradiol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of KLK6 mRNA CTD PMID:19619570 Klk6 Rat 17beta-estradiol increases expression ISO KLK6 (Homo sapiens) 6480464 Estradiol results in increased expression of KLK6 mRNA CTD PMID:19619570 and PMID:21185374 Klk6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KLK6 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of KLK6 mRNA CTD PMID:19619570 Klk6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KLK6 mRNA CTD PMID:33387578 Klk6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KLK6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KLK6 mRNA CTD PMID:19619570 and PMID:23152189 Klk6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO KLK6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLK6 mRNA CTD PMID:21632981 Klk6 Rat 2-hydroxypropanoic acid decreases expression ISO KLK6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KLK6 mRNA CTD PMID:30851411 Klk6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Klk6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KLK6 mRNA CTD PMID:20188158 Klk6 Rat 4,4'-sulfonyldiphenol decreases expression ISO KLK6 (Homo sapiens) 6480464 bisphenol S results in decreased expression of KLK6 mRNA CTD PMID:33476716 Klk6 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLK6 mRNA CTD PMID:36041667 Klk6 Rat 4-nonylphenol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of KLK6 mRNA CTD PMID:23626723 Klk6 Rat 4-tert-Octylphenol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of KLK6 mRNA CTD PMID:23626723 Klk6 Rat 5-aza-2'-deoxycytidine affects expression ISO KLK6 (Homo sapiens) 6480464 Decitabine affects the expression of KLK6 mRNA CTD PMID:23300844 Klk6 Rat 5-fluorouracil decreases expression ISO KLK6 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of KLK6 protein CTD PMID:15352031 Klk6 Rat 5-fluorouracil affects response to substance ISO KLK6 (Homo sapiens) 6480464 KLK6 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Klk6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KLK6 mRNA CTD PMID:24780913 and PMID:25825206 Klk6 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of KLK6 mRNA CTD PMID:28959563 Klk6 Rat all-trans-retinoic acid increases expression ISO KLK6 (Homo sapiens) 6480464 Tretinoin results in increased expression of KLK6 mRNA CTD PMID:21934132 Klk6 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KLK6 mRNA CTD PMID:38685447 Klk6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KLK6 mRNA CTD PMID:16483693 Klk6 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of KLK6 mRNA CTD PMID:16635253 Klk6 Rat arsane multiple interactions ISO KLK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK6 mRNA CTD PMID:32525701 Klk6 Rat arsenic atom multiple interactions ISO KLK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK6 mRNA CTD PMID:32525701 Klk6 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of KLK6 mRNA CTD PMID:21839799 Klk6 Rat benzo[a]pyrene decreases methylation ISO KLK6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KLK6 3' UTR CTD PMID:27901495 Klk6 Rat benzo[a]pyrene increases methylation ISO KLK6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KLK6 5' UTR CTD PMID:27901495 Klk6 Rat benzo[a]pyrene affects methylation ISO KLK6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KLK6 promoter CTD PMID:27901495 Klk6 Rat bis(2-chloroethyl) sulfide increases expression ISO Klk6 (Mus musculus) 6480464 Mustard Gas results in increased expression of KLK6 mRNA CTD PMID:15674844 Klk6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KLK6 mRNA CTD PMID:25181051 Klk6 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLK6 mRNA CTD PMID:36041667 Klk6 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of KLK6 mRNA CTD PMID:36041667 Klk6 Rat calcitriol increases expression ISO KLK6 (Homo sapiens) 6480464 Calcitriol results in increased expression of KLK6 mRNA CTD PMID:12040012 more ... Klk6 Rat calcitriol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KLK6 mRNA and Ketoconazole promotes the reaction [Calcitriol results in increased expression of KLK6 mRNA] CTD PMID:21592394 and PMID:26485663 Klk6 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of KLK6 mRNA CTD PMID:20349343 Klk6 Rat ciguatoxin CTX1B affects expression ISO Klk6 (Mus musculus) 6480464 Ciguatoxins affects the expression of KLK6 mRNA CTD PMID:18353800 Klk6 Rat cisplatin affects response to substance ISO KLK6 (Homo sapiens) 6480464 KLK6 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Klk6 Rat cisplatin affects expression ISO KLK6 (Homo sapiens) 6480464 Cisplatin affects the expression of KLK6 mRNA CTD PMID:23300844 Klk6 Rat copper(II) sulfate increases expression ISO KLK6 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KLK6 mRNA CTD PMID:19549813 Klk6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of KLK6 mRNA CTD PMID:26577399 and PMID:27523638 Klk6 Rat cytarabine decreases expression ISO KLK6 (Homo sapiens) 6480464 Cytarabine results in decreased expression of KLK6 mRNA CTD PMID:21198554 Klk6 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of KLK6 mRNA CTD PMID:37077353 Klk6 Rat entinostat increases expression ISO KLK6 (Homo sapiens) 6480464 entinostat results in increased expression of KLK6 mRNA CTD PMID:27188386 Klk6 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of KLK6 mRNA CTD PMID:18035473 Klk6 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KLK6 mRNA CTD PMID:33387578 Klk6 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of KLK6 mRNA CTD PMID:24395379 Klk6 Rat hydroquinone increases expression ISO KLK6 (Homo sapiens) 6480464 hydroquinone results in increased expression of KLK6 mRNA CTD PMID:31256213 Klk6 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of KLK6 mRNA CTD PMID:16635253 Klk6 Rat ketoconazole multiple interactions ISO KLK6 (Homo sapiens) 6480464 Ketoconazole promotes the reaction [Calcitriol results in increased expression of KLK6 mRNA] CTD PMID:26485663 Klk6 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of KLK6 mRNA CTD PMID:37077353 Klk6 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of KLK6 mRNA CTD PMID:22641619 Klk6 Rat lithocholic acid multiple interactions EXP 6480464 [Lithocholic Acid binds to and results in increased activity of VDR protein] which results in increased expression of KLK6 mRNA CTD PMID:21311750 Klk6 Rat methotrexate affects response to substance ISO KLK6 (Homo sapiens) 6480464 KLK6 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Klk6 Rat nickel atom increases expression ISO KLK6 (Homo sapiens) 6480464 Nickel results in increased expression of KLK6 mRNA CTD PMID:25583101 Klk6 Rat p-tert-Amylphenol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of KLK6 mRNA CTD PMID:23626723 Klk6 Rat pioglitazone multiple interactions ISO Klk6 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in increased expression of KLK6 mRNA CTD PMID:27935865 Klk6 Rat progesterone multiple interactions ISO Klk6 (Mus musculus) 6480464 [Progesterone results in increased activity of PGR protein] which results in increased expression of KLK6 mRNA CTD PMID:15845616 Klk6 Rat rac-lactic acid decreases expression ISO KLK6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KLK6 mRNA CTD PMID:30851411 Klk6 Rat resveratrol multiple interactions ISO KLK6 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of KLK6 mRNA CTD PMID:23557933 Klk6 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of KLK6 mRNA CTD PMID:22431001 Klk6 Rat sodium arsenate multiple interactions ISO KLK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLK6 mRNA CTD PMID:32525701 Klk6 Rat sodium arsenite affects methylation ISO KLK6 (Homo sapiens) 6480464 sodium arsenite affects the methylation of KLK6 gene CTD PMID:28589171 Klk6 Rat sodium arsenite increases expression ISO Klk6 (Mus musculus) 6480464 sodium arsenite results in increased expression of KLK6 mRNA CTD PMID:37682722 Klk6 Rat Soman increases expression EXP 6480464 Soman results in increased expression of KLK6 mRNA CTD PMID:19281266 Klk6 Rat testosterone increases expression ISO KLK6 (Homo sapiens) 6480464 Testosterone results in increased expression of KLK6 mRNA CTD PMID:21592394 Klk6 Rat testosterone multiple interactions ISO KLK6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KLK6 mRNA CTD PMID:21592394 Klk6 Rat titanium dioxide increases expression ISO KLK6 (Homo sapiens) 6480464 titanium dioxide results in increased expression of KLK6 mRNA CTD PMID:34973136 Klk6 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of KLK6 mRNA CTD PMID:22166486 Klk6 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of KLK6 mRNA CTD PMID:22166486 Klk6 Rat triclosan increases expression ISO KLK6 (Homo sapiens) 6480464 Triclosan results in increased expression of KLK6 mRNA CTD PMID:30510588 Klk6 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of KLK6 mRNA CTD PMID:23665938 Klk6 Rat XL147 multiple interactions ISO Klk6 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of KLK6 mRNA CTD PMID:27935865 Klk6 Rat zoledronic acid decreases expression ISO KLK6 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of KLK6 mRNA CTD PMID:24714768
1.
Enzymatic properties of rat myelencephalon-specific protease.
Blaber SI, etal., Biochemistry. 2002 Jan 29;41(4):1165-73.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Klk1 as one of the genes contributing to hypertension in Dahl salt-sensitive rat.
Iwai N, etal., Hypertension 2005 May;45(5):947-53. Epub 2005 Apr 4.
5.
Alpha-synuclein degradation by serine protease neurosin: implication for pathogenesis of synucleinopathies.
Iwata A, etal., Hum Mol Genet 2003 Oct 15;12(20):2625-35. Epub 2003 Aug 19.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Decreased cerebrospinal fluid levels of neurosin (KLK6), an aging-related protease, as a possible new risk factor for Alzheimer's disease.
Mitsui S, etal., Ann N Y Acad Sci 2002 Nov;977:216-23.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Immunohistochemical localization of human kallikreins 6, 10 and 13 in benign and malignant prostatic tissues.
Petraki CD, etal., Prostate Cancer Prostatic Dis. 2003;6(3):223-7.
10.
Prognostic implications of the immunohistochemical expression of human kallikreins 5, 6, 10 and 11 in renal cell carcinoma.
Petraki CD, etal., Tumour Biol. 2006;27(1):1-7. Epub 2005 Dec 8.
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
14.
Activity of a newly identified serine protease in CNS demyelination.
Scarisbrick IA, etal., Brain 2002 Jun;125(Pt 6):1283-96.
15.
Dynamic role of kallikrein 6 in traumatic spinal cord injury.
Scarisbrick IA, etal., Eur J Neurosci. 2006 Sep;24(5):1457-69.
16.
Nervous system-specific expression of a novel serine protease: regulation in the adult rat spinal cord by excitotoxic injury.
Scarisbrick IA, etal., J Neurosci 1997 Nov 1;17(21):8156-68.
17.
Ovarian cancer specific kallikrein profile in effusions.
Shih IeM, etal., Gynecol Oncol. 2007 May;105(2):501-7. Epub 2007 Feb 15.
18.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.
[Expression of KLK6 protein and mRNA in primary breast cancer and its clinical significance.]
Wang SM, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2008 Nov;24(11):1087-9.
20.
Decreased concentration of human kallikrein 6 in brain extracts of Alzheimer's disease patients.
Zarghooni M, etal., Clin Biochem 2002 May;35(3):225-31.
Klk6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 103,415,411 - 103,422,682 (+) NCBI GRCr8 mRatBN7.2 1 94,278,863 - 94,286,136 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 94,280,340 - 94,286,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 99,664,377 - 99,671,533 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 108,137,048 - 108,144,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 101,426,648 - 101,433,802 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 99,762,195 - 99,769,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 99,762,253 - 99,769,488 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 100,830,974 - 100,838,254 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 94,254,350 - 94,261,500 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 94,332,460 - 94,339,610 (+) NCBI Celera 1 88,546,437 - 88,553,549 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
KLK6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 50,958,631 - 50,969,591 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 50,958,631 - 50,969,673 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 51,461,887 - 51,472,847 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 56,153,699 - 56,164,741 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 56,153,699 - 56,164,741 NCBI Celera 19 48,512,220 - 48,523,480 (-) NCBI Celera Cytogenetic Map 19 q13.41 NCBI HuRef 19 47,794,177 - 47,805,721 (-) NCBI HuRef CHM1_1 19 51,463,632 - 51,474,713 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 54,046,713 - 54,057,995 (-) NCBI T2T-CHM13v2.0
Klk6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 43,473,967 - 43,481,219 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 43,473,923 - 43,481,454 (+) Ensembl GRCm39 Ensembl GRCm38 7 43,824,438 - 43,832,027 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 43,824,499 - 43,832,030 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 51,079,914 - 51,087,397 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 43,693,492 - 43,699,828 (+) NCBI MGSCv36 mm8 Celera 7 39,293,226 - 39,300,707 (+) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 28.28 NCBI
Klk6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955558 1,502,881 - 1,509,558 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955558 1,501,806 - 1,509,461 (+) NCBI ChiLan1.0 ChiLan1.0
KLK6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 57,028,080 - 57,039,362 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 58,948,642 - 58,959,921 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 47,925,017 - 47,936,314 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 56,815,073 - 56,826,689 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 56,815,073 - 56,826,689 (-) Ensembl panpan1.1 panPan2
KLK6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 105,902,147 - 105,907,585 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 105,474,567 - 105,482,203 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 106,409,595 - 106,419,174 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 106,406,669 - 106,433,683 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 106,082,387 - 106,090,003 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 105,723,801 - 105,731,455 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 106,519,343 - 106,526,983 (+) NCBI UU_Cfam_GSD_1.0
Klk6
KLK6
KLK6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 43,980,680 - 43,991,873 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 43,980,701 - 43,990,060 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 24,005,498 - 24,016,398 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klk6
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 66 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000065876 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
MCMA27
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 94,281,963 - 94,282,284 (+) MAPPER mRatBN7.2 Rnor_6.0 1 99,765,318 - 99,765,638 NCBI Rnor6.0 Rnor_5.0 1 100,834,076 - 100,834,396 UniSTS Rnor5.0 RGSC_v3.4 1 94,257,344 - 94,257,664 UniSTS RGSC3.4 Celera 1 88,549,431 - 88,549,751 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
4
7
58
35
40
11
15
11
6
61
34
44
6
27
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065876 ⟹ ENSRNOP00000060676
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 94,280,340 - 94,286,121 (+) Ensembl Rnor_6.0 Ensembl 1 99,762,253 - 99,769,488 (+) Ensembl
RefSeq Acc Id:
NM_019175 ⟹ NP_062048
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 103,415,516 - 103,422,668 (+) NCBI mRatBN7.2 1 94,278,970 - 94,286,122 (+) NCBI Rnor_6.0 1 99,762,324 - 99,769,472 (+) NCBI Rnor_5.0 1 100,830,974 - 100,838,254 (+) NCBI RGSC_v3.4 1 94,254,350 - 94,261,500 (+) RGD Celera 1 88,546,437 - 88,553,549 (+) RGD
Sequence:
GACACGGAGGTCTTCAGCACCCACAGAGGGACTTACAGGTCGGATCATAAGGCAACCTTCTGTCAGTCTGCTCTGCCCCTTCTCTTGTGGAGCACCCTGCCTTGCTGACTTTCTCTGCCTGTGATAGG
hide sequence
RefSeq Acc Id:
XM_006228982 ⟹ XP_006229044
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 103,415,411 - 103,422,682 (+) NCBI mRatBN7.2 1 94,278,863 - 94,286,136 (+) NCBI Rnor_6.0 1 99,762,195 - 99,769,486 (+) NCBI Rnor_5.0 1 100,830,974 - 100,838,254 (+) NCBI
Sequence:
AATGCCCAATTGTTGGAAGACTCTTTCCCCATATTGCTCATGCTGCTTCCCGGCCTGGGTTAGGGGTGGGGGACAGTTTAGTGAAACACCCTTTCTCAATAGCTGGGTGGCAGCTCCCACTCTCCTCG
hide sequence
RefSeq Acc Id:
NP_062048 ⟸ NM_019175
- Peptide Label:
precursor
- UniProtKB:
O54854 (UniProtKB/TrEMBL), F7F6H9 (UniProtKB/TrEMBL), A0A1R3UDT9 (UniProtKB/TrEMBL)
- Sequence:
MPTKMLTVKTLALCLILAKSAWSEDQDKVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVGPQWVLTAAHCKKPNLEVYLGKHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMMVHLKRPVKFSQR
hide sequence
RefSeq Acc Id:
XP_006229044 ⟸ XM_006228982
- Peptide Label:
isoform X1
- UniProtKB:
O54854 (UniProtKB/TrEMBL), F7F6H9 (UniProtKB/TrEMBL), A0A1R3UDT9 (UniProtKB/TrEMBL)
- Sequence:
MPTKMLTVKTLALCLILAKSAWSEDQDKVVHGGPCLKNSHPFQAALYTSGHLLCGGVLVGPQWVLTAAHCKKPNLEVYLGKHNLRQTETFQRQISVDRTIVHPRYNPQTHDNDIMMVHLKRPVKFSQR
hide sequence
Ensembl Acc Id:
ENSRNOP00000060676 ⟸ ENSRNOT00000065876
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-15
Klk6
kallikrein related-peptidase 6
Klk6
kallikrein 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Klk6
kallikrein 6
kallikrein 6
Symbol and Name status set to approved
1299863 APPROVED
2002-06-10
Klk6
kallikrein 6
Name updated
70585 PROVISIONAL
2001-12-10
Klk6
kallikrein 6 (neurosin)
Symbol and Name updated to reflect Human and Mouse nomenclature
69665 APPROVED
Note Type
Note
Reference
gene_expression
expression is 10 fold greater in the spinal cord and 4 fold greater in the medulla oblongata as compared to the other tissues
69940
gene_homology
sequence similar to neuropsin and trypsin
69940
gene_process
may be involved in normal homeostasis and the response of the spinal cord to injury
69940
