Symbol:
Pcsk6
Name:
proprotein convertase subtilisin/kexin type 6
RGD ID:
3246
Description:
Predicted to enable heparin binding activity; nerve growth factor binding activity; and serine-type endopeptidase activity. Involved in peptide hormone processing. Predicted to be active in several cellular components, including cell surface; collagen-containing extracellular matrix; and extracellular space. Orthologous to human PCSK6 (proprotein convertase subtilisin/kexin type 6); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
kexin-like protease PC7A; PACE4; paired basic amino acid cleaving enzyme 4; Spc4; Subtilisin - like endoprotease; subtilisin-like proprotein convertase 4; subtilisin/kexin-like protease PACE4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 128,839,742 - 129,038,087 (+) NCBI GRCr8 mRatBN7.2 1 119,428,978 - 119,627,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 119,429,265 - 119,627,596 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 127,422,899 - 127,620,747 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 134,594,338 - 134,792,193 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 127,403,150 - 127,601,477 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 126,749,508 - 126,947,392 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 126,749,508 - 126,947,392 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 127,884,080 - 128,033,742 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 120,324,843 - 120,476,913 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 120,403,185 - 120,555,256 (+) NCBI Celera 1 111,644,666 - 111,839,248 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pcsk6 Rat 1,2-dimethylhydrazine increases expression ISO Pcsk6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PCSK6 mRNA CTD PMID:22206623 Pcsk6 Rat 17alpha-ethynylestradiol affects expression ISO Pcsk6 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PCSK6 mRNA CTD PMID:17555576 Pcsk6 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PCSK6 mRNA CTD PMID:12655037 and PMID:17557909 Pcsk6 Rat 17alpha-ethynylestradiol multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PCSK6 mRNA CTD PMID:17942748 Pcsk6 Rat 17alpha-ethynylestradiol increases expression ISO Pcsk6 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PCSK6 mRNA CTD PMID:17942748 Pcsk6 Rat 17beta-estradiol multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PCSK6 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of PCSK6 mRNA CTD PMID:17404688 and PMID:20660070 Pcsk6 Rat 17beta-estradiol decreases expression ISO Pcsk6 (Mus musculus) 6480464 Estradiol results in decreased expression of PCSK6 mRNA CTD PMID:39298647 Pcsk6 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PCSK6 mRNA CTD PMID:32145629 Pcsk6 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PCSK6 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Pcsk6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PCSK6 mRNA CTD PMID:17942748 Pcsk6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pcsk6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK6 mRNA CTD PMID:32553695 Pcsk6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK6 mRNA CTD PMID:32109520 Pcsk6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pcsk6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PCSK6 mRNA CTD PMID:24680724 and PMID:26377647 Pcsk6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pcsk6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PCSK6 mRNA CTD PMID:17035482 Pcsk6 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pcsk6 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pcsk6 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PCSK6 mRNA CTD PMID:21346803 Pcsk6 Rat 2-hydroxypropanoic acid decreases expression ISO PCSK6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PCSK6 mRNA CTD PMID:30851411 Pcsk6 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO PCSK6 (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Pcsk6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Pcsk6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PCSK6 mRNA CTD PMID:20188158 Pcsk6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Pcsk6 (Mus musculus) 6480464 bisphenol S results in decreased expression of PCSK6 mRNA CTD PMID:39298647 Pcsk6 Rat 4,4'-sulfonyldiphenol increases expression ISO PCSK6 (Homo sapiens) 6480464 bisphenol S results in increased expression of PCSK6 protein CTD PMID:33181973 Pcsk6 Rat 4-hydroxyphenyl retinamide decreases expression ISO Pcsk6 (Mus musculus) 6480464 Fenretinide results in decreased expression of PCSK6 mRNA CTD PMID:28973697 Pcsk6 Rat 5-aza-2'-deoxycytidine multiple interactions ISO PCSK6 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of PCSK6 mRNA] CTD PMID:21095227 Pcsk6 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PCSK6 mRNA CTD PMID:24780913 Pcsk6 Rat 7,12-dimethyltetraphene decreases expression ISO Pcsk6 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Pcsk6 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PCSK6 mRNA CTD PMID:31881176 Pcsk6 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PCSK6 mRNA CTD PMID:28959563 Pcsk6 Rat aflatoxin B1 decreases expression ISO Pcsk6 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PCSK6 mRNA CTD PMID:19770486 Pcsk6 Rat aflatoxin B1 affects expression ISO PCSK6 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PCSK6 protein CTD PMID:20106945 Pcsk6 Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of PCSK6 mRNA CTD PMID:12419858 Pcsk6 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PCSK6 mRNA CTD PMID:35163327 Pcsk6 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PCSK6 mRNA CTD PMID:16483693 Pcsk6 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of PCSK6 mRNA CTD PMID:16635253 Pcsk6 Rat antirheumatic drug decreases expression ISO PCSK6 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PCSK6 mRNA CTD PMID:24449571 Pcsk6 Rat arsane multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PCSK6 mRNA CTD PMID:32525701 Pcsk6 Rat arsane affects methylation ISO PCSK6 (Homo sapiens) 6480464 Arsenic affects the methylation of PCSK6 gene CTD PMID:25304211 Pcsk6 Rat arsenic atom multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PCSK6 mRNA CTD PMID:32525701 Pcsk6 Rat arsenic atom affects methylation ISO PCSK6 (Homo sapiens) 6480464 Arsenic affects the methylation of PCSK6 gene CTD PMID:25304211 Pcsk6 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PCSK6 gene CTD PMID:35440735 Pcsk6 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat benzo[a]pyrene decreases expression ISO Pcsk6 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of PCSK6 mRNA and Benzo(a)pyrene results in decreased expression of PCSK6 mRNA CTD PMID:21715664 and PMID:32553695 Pcsk6 Rat benzo[a]pyrene affects methylation ISO PCSK6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PCSK6 intron CTD PMID:30157460 Pcsk6 Rat benzo[a]pyrene decreases methylation ISO PCSK6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PCSK6 promoter CTD PMID:27901495 Pcsk6 Rat benzo[a]pyrene increases expression ISO Pcsk6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PCSK6 mRNA CTD PMID:25908611 Pcsk6 Rat benzo[a]pyrene decreases expression ISO PCSK6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PCSK6 mRNA CTD PMID:20064835 more ... Pcsk6 Rat benzo[e]pyrene increases methylation ISO PCSK6 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PCSK6 intron CTD PMID:30157460 Pcsk6 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PCSK6 3' UTR CTD PMID:33872906 Pcsk6 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PCSK6 mRNA CTD PMID:25181051 Pcsk6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PCSK6 mRNA CTD PMID:32145629 Pcsk6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PCSK6 mRNA CTD PMID:30816183 Pcsk6 Rat bisphenol F increases expression ISO Pcsk6 (Mus musculus) 6480464 bisphenol F results in increased expression of PCSK6 mRNA CTD PMID:38685157 Pcsk6 Rat butanal decreases expression ISO PCSK6 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PCSK6 mRNA CTD PMID:26079696 Pcsk6 Rat cadmium dichloride decreases expression ISO PCSK6 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PCSK6 mRNA CTD PMID:38568856 Pcsk6 Rat calcitriol multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PCSK6 mRNA CTD PMID:21592394 Pcsk6 Rat calcitriol decreases expression ISO PCSK6 (Homo sapiens) 6480464 Calcitriol results in decreased expression of PCSK6 mRNA CTD PMID:21592394 Pcsk6 Rat carbon nanotube decreases expression ISO Pcsk6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pcsk6 Rat choline multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PCSK6 mRNA CTD PMID:20938992 Pcsk6 Rat chromium(6+) affects expression ISO Pcsk6 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PCSK6 mRNA CTD PMID:28472532 Pcsk6 Rat cisplatin decreases expression ISO PCSK6 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PCSK6 mRNA CTD PMID:27392435 Pcsk6 Rat cisplatin multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PCSK6 mRNA CTD PMID:27392435 Pcsk6 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat clofibrate decreases expression ISO Pcsk6 (Mus musculus) 6480464 Clofibrate results in decreased expression of PCSK6 mRNA CTD PMID:17585979 Pcsk6 Rat copper(II) sulfate decreases expression ISO PCSK6 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PCSK6 mRNA CTD PMID:19549813 Pcsk6 Rat coumestrol multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Pcsk6 Rat coumestrol decreases expression ISO PCSK6 (Homo sapiens) 6480464 Coumestrol results in decreased expression of PCSK6 mRNA CTD PMID:19167446 Pcsk6 Rat cyclosporin A decreases expression ISO PCSK6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PCSK6 mRNA CTD PMID:20106945 Pcsk6 Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of PCSK6 gene CTD PMID:31682807 Pcsk6 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PCSK6 mRNA CTD PMID:17005392 Pcsk6 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PCSK6 mRNA CTD PMID:25152437 Pcsk6 Rat dorsomorphin multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCSK6 mRNA CTD PMID:27188386 Pcsk6 Rat doxorubicin decreases expression ISO PCSK6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PCSK6 mRNA CTD PMID:29803840 Pcsk6 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PCSK6 mRNA CTD PMID:29391264 Pcsk6 Rat Enterolactone multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of PCSK6 mRNA CTD PMID:19167446 Pcsk6 Rat ethanol increases expression ISO Pcsk6 (Mus musculus) 6480464 Ethanol results in increased expression of PCSK6 mRNA CTD PMID:30319688 Pcsk6 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PCSK6 mRNA CTD PMID:24136188 Pcsk6 Rat folic acid multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PCSK6 mRNA CTD PMID:20938992 Pcsk6 Rat inulin multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PCSK6 mRNA CTD PMID:36331819 Pcsk6 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of PCSK6 mRNA CTD PMID:16635253 Pcsk6 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat L-methionine multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PCSK6 mRNA CTD PMID:20938992 Pcsk6 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PCSK6 mRNA CTD PMID:24136188 Pcsk6 Rat manganese atom multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PCSK6 mRNA CTD PMID:39836092 Pcsk6 Rat manganese(0) multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PCSK6 mRNA CTD PMID:39836092 Pcsk6 Rat manganese(II) chloride multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PCSK6 mRNA CTD PMID:39836092 Pcsk6 Rat mercury dichloride increases expression ISO PCSK6 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of PCSK6 mRNA CTD PMID:27188386 Pcsk6 Rat methapyrilene increases methylation ISO PCSK6 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PCSK6 intron CTD PMID:30157460 Pcsk6 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PCSK6 gene CTD PMID:35440735 Pcsk6 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PCSK6 3' UTR CTD PMID:33872906 Pcsk6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PCSK6 mRNA CTD PMID:20360939 Pcsk6 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PCSK6 mRNA CTD PMID:24136188 Pcsk6 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of PCSK6 mRNA CTD PMID:27638505 Pcsk6 Rat paracetamol affects expression ISO Pcsk6 (Mus musculus) 6480464 Acetaminophen affects the expression of PCSK6 mRNA CTD PMID:17562736 Pcsk6 Rat paracetamol decreases expression ISO PCSK6 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PCSK6 mRNA CTD PMID:29067470 Pcsk6 Rat perfluorohexanesulfonic acid decreases expression ISO Pcsk6 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of PCSK6 mRNA CTD PMID:37995155 Pcsk6 Rat perfluorononanoic acid decreases expression ISO PCSK6 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PCSK6 mRNA CTD PMID:32588087 Pcsk6 Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of PCSK6 mRNA CTD PMID:18692542 Pcsk6 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pcsk6 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PCSK6 mRNA CTD PMID:36331819 Pcsk6 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PCSK6 mRNA CTD PMID:35163327 Pcsk6 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PCSK6 mRNA CTD PMID:20360939 Pcsk6 Rat phenobarbital affects expression ISO PCSK6 (Homo sapiens) 6480464 Phenobarbital affects the expression of PCSK6 mRNA CTD PMID:19159669 Pcsk6 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PCSK6 mRNA CTD PMID:18158353 Pcsk6 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat pirinixic acid increases expression ISO Pcsk6 (Mus musculus) 6480464 pirinixic acid results in increased expression of PCSK6 mRNA CTD PMID:23811191 Pcsk6 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PCSK6 mRNA CTD PMID:19162173 Pcsk6 Rat progesterone multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PCSK6 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of PCSK6 mRNA CTD PMID:17404688 and PMID:20660070 Pcsk6 Rat progesterone increases expression ISO PCSK6 (Homo sapiens) 6480464 Progesterone results in increased expression of PCSK6 mRNA CTD PMID:17404688 and PMID:18070364 Pcsk6 Rat propanal decreases expression ISO PCSK6 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of PCSK6 mRNA CTD PMID:26079696 Pcsk6 Rat rac-lactic acid decreases expression ISO PCSK6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PCSK6 mRNA CTD PMID:30851411 Pcsk6 Rat resveratrol multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of PCSK6 mRNA CTD PMID:19167446 Pcsk6 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PCSK6 mRNA CTD PMID:28374803 Pcsk6 Rat SB 431542 multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCSK6 mRNA CTD PMID:27188386 Pcsk6 Rat silicon dioxide decreases expression ISO PCSK6 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PCSK6 mRNA CTD PMID:25895662 Pcsk6 Rat silicon dioxide increases expression ISO PCSK6 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PCSK6 mRNA CTD PMID:23806026 Pcsk6 Rat sodium arsenate multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PCSK6 mRNA CTD PMID:32525701 Pcsk6 Rat sodium arsenite decreases expression ISO PCSK6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PCSK6 mRNA CTD PMID:38568856 Pcsk6 Rat sodium arsenite decreases expression ISO Pcsk6 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PCSK6 mRNA CTD PMID:37682722 Pcsk6 Rat sodium arsenite increases expression ISO PCSK6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PCSK6 mRNA CTD PMID:34032870 Pcsk6 Rat sodium dodecyl sulfate increases expression ISO PCSK6 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of PCSK6 mRNA CTD PMID:31734321 Pcsk6 Rat sodium fluoride decreases expression ISO Pcsk6 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PCSK6 mRNA CTD PMID:27862939 Pcsk6 Rat tamoxifen increases expression ISO Pcsk6 (Mus musculus) 6480464 Tamoxifen results in increased expression of PCSK6 mRNA CTD PMID:25123088 Pcsk6 Rat testosterone multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PCSK6 mRNA CTD PMID:21592394 Pcsk6 Rat testosterone decreases expression ISO PCSK6 (Homo sapiens) 6480464 Testosterone results in decreased expression of PCSK6 mRNA CTD PMID:21592394 Pcsk6 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PCSK6 mRNA CTD PMID:19483382 Pcsk6 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PCSK6 mRNA CTD PMID:34492290 Pcsk6 Rat titanium dioxide decreases expression ISO Pcsk6 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PCSK6 mRNA CTD PMID:23557971 Pcsk6 Rat titanium dioxide decreases methylation ISO Pcsk6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PCSK6 gene CTD PMID:35295148 Pcsk6 Rat triclosan increases expression ISO PCSK6 (Homo sapiens) 6480464 Triclosan results in increased expression of PCSK6 mRNA CTD PMID:30510588 Pcsk6 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of PCSK6 mRNA CTD PMID:30589522 Pcsk6 Rat triphenyl phosphate affects expression ISO PCSK6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PCSK6 mRNA CTD PMID:37042841 Pcsk6 Rat troglitazone decreases expression ISO PCSK6 (Homo sapiens) 6480464 troglitazone results in decreased expression of PCSK6 mRNA CTD PMID:25572481 Pcsk6 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PCSK6 mRNA CTD PMID:24136188 Pcsk6 Rat valproic acid increases methylation ISO PCSK6 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PCSK6 gene CTD PMID:29154799 Pcsk6 Rat valproic acid multiple interactions ISO PCSK6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCSK6 mRNA CTD PMID:27188386 Pcsk6 Rat valproic acid increases expression ISO PCSK6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PCSK6 mRNA CTD PMID:24383497 and PMID:26272509 Pcsk6 Rat vancomycin increases expression ISO Pcsk6 (Mus musculus) 6480464 Vancomycin results in increased expression of PCSK6 mRNA CTD PMID:18930951
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) alachlor (EXP) alpha-Zearalanol (EXP) amiodarone (EXP) ammonium chloride (EXP) Ampullosporin (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) DDT (EXP) diethylstilbestrol (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) inulin (ISO) ketamine (EXP) L-ethionine (EXP) L-methionine (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methapyrilene (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) omeprazole (EXP) p-toluidine (EXP) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phenethyl caffeate (EXP) phenobarbital (ISO) phenylephrine (EXP) pirinixic acid (EXP,ISO) progesterone (ISO) propanal (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) tamoxifen (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) triclosan (ISO) triphenyl phosphate (EXP,ISO) troglitazone (ISO) trovafloxacin (EXP) valproic acid (ISO) vancomycin (ISO)
Biological Process
determination of left/right symmetry (IEA,ISO) glycoprotein metabolic process (IEA,ISO) nerve growth factor production (IEA,ISO) peptide hormone processing (IBA,IEA,IEP,ISO) protein processing (IEA,ISO) proteolysis (IEA) secretion by cell (IEA,ISO) zygotic determination of anterior/posterior axis, embryo (IEA,ISO)
Pcsk6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 128,839,742 - 129,038,087 (+) NCBI GRCr8 mRatBN7.2 1 119,428,978 - 119,627,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 119,429,265 - 119,627,596 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 127,422,899 - 127,620,747 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 134,594,338 - 134,792,193 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 127,403,150 - 127,601,477 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 126,749,508 - 126,947,392 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 126,749,508 - 126,947,392 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 127,884,080 - 128,033,742 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 120,324,843 - 120,476,913 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 120,403,185 - 120,555,256 (+) NCBI Celera 1 111,644,666 - 111,839,248 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
PCSK6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 101,303,933 - 101,489,707 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 101,289,784 - 101,525,202 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 101,844,138 - 102,029,910 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 99,661,656 - 99,847,710 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 15 78,256,961 - 78,396,788 (-) NCBI Celera Cytogenetic Map 15 q26.3 NCBI HuRef 15 77,966,553 - 78,106,326 (-) NCBI HuRef CHM1_1 15 101,685,119 - 101,871,305 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 99,058,998 - 99,244,970 (-) NCBI T2T-CHM13v2.0
Pcsk6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 65,511,884 - 65,700,134 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 65,511,482 - 65,700,134 (+) Ensembl GRCm39 Ensembl GRCm38 7 65,862,136 - 66,050,386 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 65,861,734 - 66,050,386 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 73,007,022 - 73,195,272 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 65,740,684 - 65,929,336 (+) NCBI MGSCv36 mm8 Celera 7 63,292,677 - 63,485,752 (+) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 35.36 NCBI
Pcsk6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 28,184,768 - 28,314,759 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 28,184,768 - 28,314,697 (-) NCBI ChiLan1.0 ChiLan1.0
PCSK6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 90,890,545 - 91,092,337 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 94,591,746 - 94,792,956 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 80,029,225 - 80,226,027 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 99,312,512 - 99,456,295 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 99,312,512 - 99,460,444 (-) Ensembl panpan1.1 panPan2
PCSK6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 39,582,804 - 39,768,838 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 39,582,819 - 39,767,929 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 42,273,277 - 42,458,425 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 39,974,680 - 40,160,403 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 39,974,274 - 40,160,332 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 39,508,310 - 39,693,874 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 39,735,714 - 39,930,680 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 39,946,780 - 40,132,048 (+) NCBI UU_Cfam_GSD_1.0
Pcsk6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 143,773,158 - 143,960,126 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 2,374,357 - 2,561,384 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 2,374,357 - 2,561,322 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PCSK6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 145,508,534 - 145,695,666 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 145,508,658 - 145,697,017 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 311,243,196 - 311,347,239 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PCSK6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 19,758,198 - 19,949,875 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 19,754,625 - 19,949,382 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 26,590,273 - 26,782,701 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pcsk6
.
Predicted Target Of
Count of predictions: 159 Count of miRNA genes: 108 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000015845 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 631569 Bp93 Blood pressure QTL 93 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 121834139 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
D50060
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 119,626,349 - 119,626,534 (+) MAPPER mRatBN7.2 Rnor_6.0 1 126,946,146 - 126,946,330 NCBI Rnor6.0 Rnor_5.0 1 128,032,496 - 128,032,680 UniSTS Rnor5.0 RGSC_v3.4 1 120,475,667 - 120,475,851 UniSTS RGSC3.4 Celera 1 111,838,002 - 111,838,186 UniSTS Cytogenetic Map 1 q22 UniSTS
RH129145
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 119,627,392 - 119,627,595 (+) MAPPER mRatBN7.2 Rnor_6.0 1 126,947,189 - 126,947,391 NCBI Rnor6.0 Rnor_5.0 1 128,033,539 - 128,033,741 UniSTS Rnor5.0 RGSC_v3.4 1 120,476,710 - 120,476,912 UniSTS RGSC3.4 Celera 1 111,839,045 - 111,839,247 UniSTS RH 3.4 Map 1 1451.8 UniSTS Cytogenetic Map 1 q22 UniSTS
D1Bda24
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 q22 UniSTS
BI275853
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 119,625,004 - 119,625,164 (+) MAPPER mRatBN7.2 Rnor_6.0 1 126,944,801 - 126,944,960 NCBI Rnor6.0 Rnor_5.0 1 128,031,151 - 128,031,310 UniSTS Rnor5.0 RGSC_v3.4 1 120,474,322 - 120,474,481 UniSTS RGSC3.4 Celera 1 111,836,657 - 111,836,816 UniSTS RH 3.4 Map 1 1448.59 UniSTS Cytogenetic Map 1 q22 UniSTS
RH36675
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 119,481,800 - 119,482,370 (+) MAPPER mRatBN7.2 Rnor_6.0 1 126,802,139 - 126,802,708 NCBI Rnor6.0 Rnor_5.0 1 127,888,922 - 127,889,491 UniSTS Rnor5.0 RGSC_v3.4 1 120,329,685 - 120,330,254 UniSTS RGSC3.4 Celera 1 111,695,897 - 111,696,466 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015845 ⟹ ENSRNOP00000015845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 119,429,265 - 119,627,596 (+) Ensembl Rnor_6.0 Ensembl 1 126,749,508 - 126,947,392 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106454 ⟹ ENSRNOP00000078906
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 119,429,265 - 119,627,596 (+) Ensembl
RefSeq Acc Id:
NM_012999 ⟹ NP_037131
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 128,839,742 - 129,038,057 (+) NCBI mRatBN7.2 1 119,429,265 - 119,627,596 (+) NCBI Rnor_6.0 1 126,749,508 - 126,947,392 (+) NCBI Rnor_5.0 1 127,884,080 - 128,033,742 (+) NCBI RGSC_v3.4 1 120,324,843 - 120,476,913 (+) RGD Celera 1 111,644,666 - 111,839,248 (+) RGD
Sequence:
TCGGGCGCCGCGCGAGCCTGCCGCTGCCATGCCTCCGCGCGCGCCGCCAGCGCCCGGGCCCCGGCCGCCGCCCCGGGCCGCCGGCCGGCACGGGCTCTCGCCGCTGGCGCCGCGCCCCTGGCGTTGGC
hide sequence
RefSeq Acc Id:
XM_039101796 ⟹ XP_038957724
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 128,839,770 - 129,038,087 (+) NCBI mRatBN7.2 1 119,428,978 - 119,627,626 (+) NCBI
RefSeq Acc Id:
XM_039101798 ⟹ XP_038957726
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 128,914,714 - 129,038,087 (+) NCBI mRatBN7.2 1 119,504,240 - 119,627,626 (+) NCBI
RefSeq Acc Id:
NP_037131 ⟸ NM_012999
- Peptide Label:
precursor
- UniProtKB:
Q63415 (UniProtKB/Swiss-Prot), F1LNB4 (UniProtKB/TrEMBL)
- Sequence:
MPPRAPPAPGPRPPPRAAGRHGLSPLAPRPWRWLLLLALPAVCSALPPPRPVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000015845 ⟸ ENSRNOT00000015845
RefSeq Acc Id:
XP_038957724 ⟸ XM_039101796
- Peptide Label:
isoform X1
- UniProtKB:
Q63415 (UniProtKB/Swiss-Prot), A0A8I5ZLS8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957726 ⟸ XM_039101798
- Peptide Label:
isoform X2
- UniProtKB:
A6JBN6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078906 ⟸ ENSRNOT00000106454
RGD ID: 13690101 Promoter ID: EPDNEW_R625 Type: single initiation site Name: Pcsk6_1 Description: proprotein convertase subtilisin/kexin type 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 126,749,499 - 126,749,559 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-01
Pcsk6
proprotein convertase subtilisin/kexin type 6
Pace4
Subtilisin - like endoprotease
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2002-06-10
Pace4
Subtilisin - like endoprotease
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_product
member of the subtilisin-like prohormone convertase family
729476
