Myf6 (myogenic factor 6) - Rat Genome Database

Name: Myf6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Myf6 (myogenic factor 6) Rattus norvegicus

Analyze

Symbol:

Myf6

Name:

myogenic factor 6

RGD ID:

3134

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in skeletal muscle tissue regeneration. Predicted to be located in cytosol; mitotic spindle; and nucleoplasm. Human ortholog(s) of this gene implicated in congenital structural myopathy. Orthologous to human MYF6 (myogenic factor 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MRF4AA; muscle-specific regulatory factor 4; myf-6; Myogenic factor 6 (herculin); myogenic factor 6 (herculin)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYF6 (myogenic factor 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Myf6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Myf6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYF6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYF6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myf6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MYF6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MYF6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myf6 (myogenic factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DYNLT1 (dynein light chain Tctex-type 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Myf6 (myogenic factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MYF6 (myogenic factor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	myf6 (myogenic factor 6)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hlh-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nau	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	myf6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	44,699,469 - 44,701,313 (-)	NCBI		GRCr8
mRatBN7.2	7	42,813,008 - 42,814,852 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	42,812,792 - 42,814,852 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	44,725,494 - 44,727,332 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	46,928,575 - 46,930,413 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	46,706,401 - 46,708,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	49,739,643 - 49,741,490 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	49,739,646 - 49,741,540 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	49,749,554 - 49,751,448 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	46,199,972 - 46,201,867 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	46,220,242 - 46,222,138 (-)	NCBI
Celera	7	39,685,604 - 39,687,449 (-)	NCBI		Celera
RH 3.4 Map	7	346.21	RGD
RH 3.4 Map	7	351.6	RGD
Cytogenetic Map	7	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant centronuclear myopathy (ISO)

centronuclear myopathy 1 (ISO)

congenital structural myopathy (ISO)

tubular aggregate myopathy 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

dexamethasone (ISO)

dorsomorphin (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (ISO)

paracetamol (ISO)

perfluorooctanoic acid (EXP)

pioglitazone (ISO)

SB 431542 (ISO)

spermine (ISO)

valproic acid (ISO)

vorinostat (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

muscle organ development (IEA)

muscle tissue morphogenesis (ISO)

negative regulation of DNA-templated transcription (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of myoblast differentiation (IBA)

positive regulation of skeletal muscle fiber development (IBA)

positive regulation of transcription by RNA polymerase II (IEA)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA)

skeletal muscle cell differentiation (IBA,ISO)

skeletal muscle tissue development (ISO)

skeletal muscle tissue regeneration (IMP)

somitogenesis (ISO)

Cellular Component

cytosol (IEA,ISO)

membrane (IEA)

mitotic spindle (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Structure and myofiber-specific expression of the rat muscle regulatory gene MRF4.	Hinterberger TJ, etal., Gene 1992 Aug 15;117(2):201-7.
4.	Heterozygous myogenic factor 6 mutation associated with myopathy and severe course of Becker muscular dystrophy.	Kerst B, etal., Neuromuscul Disord. 2000 Dec;10(8):572-7.
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Regeneration of transgenic skeletal muscles with altered timing of expression of the basic helix-loop-helix muscle regulatory factor MRF4.	Pavlath GK, etal., Am J Pathol. 2003 May;162(5):1685-91.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Identification of MRF4: a new member of the muscle regulatory factor gene family.	Rhodes SJ and Konieczny SF, Genes Dev 1989 Dec;3(12B):2050-61.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	MRF4 protein expression in regenerating rat muscle.	Zhou Z and Bornemann A, J Muscle Res Cell Motil 2001;22(4):311-6.

Additional References at PubMed

PMID:7588068	PMID:7720708	PMID:7797078	PMID:19531352	PMID:22147266	PMID:22464481	PMID:24361185	PMID:27484840

Genomics

Comparative Map Data

Myf6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	44,699,469 - 44,701,313 (-)	NCBI		GRCr8
mRatBN7.2	7	42,813,008 - 42,814,852 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	42,812,792 - 42,814,852 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	44,725,494 - 44,727,332 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	46,928,575 - 46,930,413 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	46,706,401 - 46,708,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	49,739,643 - 49,741,490 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	49,739,646 - 49,741,540 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	49,749,554 - 49,751,448 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	46,199,972 - 46,201,867 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	46,220,242 - 46,222,138 (-)	NCBI
Celera	7	39,685,604 - 39,687,449 (-)	NCBI		Celera
RH 3.4 Map	7	346.21	RGD
RH 3.4 Map	7	351.6	RGD
Cytogenetic Map	7	q21	NCBI

MYF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	80,707,634 - 80,709,474 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	80,707,634 - 80,709,474 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	81,101,413 - 81,103,253 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	79,625,577 - 79,627,382 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	79,603,913 - 79,605,719	NCBI
Celera	12	80,767,622 - 80,769,471 (+)	NCBI		Celera
Cytogenetic Map	12	q21.31	NCBI
HuRef	12	78,158,292 - 78,160,141 (+)	NCBI		HuRef
CHM1_1	12	81,067,815 - 81,069,664 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	80,686,341 - 80,688,181 (+)	NCBI		T2T-CHM13v2.0

Myf6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	107,328,709 - 107,330,584 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	107,328,714 - 107,330,598 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	107,492,848 - 107,494,723 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	107,492,853 - 107,494,737 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	106,929,916 - 106,931,785 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	106,896,970 - 106,898,839 (-)	NCBI		MGSCv36	mm8
Celera	10	109,435,323 - 109,437,177 (-)	NCBI		Celera
Cytogenetic Map	10	D1	NCBI
cM Map	10	55.96	NCBI

Myf6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	19,336,718 - 19,338,670 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	19,336,798 - 19,338,610 (+)	NCBI	ChiLan1.0	ChiLan1.0

MYF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	88,754,609 - 88,757,547 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	88,751,004 - 88,753,942 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	78,226,562 - 78,229,470 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	81,338,339 - 81,340,176 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	81,338,339 - 81,340,176 (+)	Ensembl	panpan1.1		panPan2

MYF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	23,039,090 - 23,041,092 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	23,039,416 - 23,041,019 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	23,462,866 - 23,467,438 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	23,399,954 - 23,404,522 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	23,400,261 - 23,401,845 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	22,977,287 - 22,981,857 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	23,036,794 - 23,041,335 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	23,277,134 - 23,281,706 (+)	NCBI		UU_Cfam_GSD_1.0

Myf6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	37,311,426 - 37,313,351 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936698	1,599,101 - 1,601,078 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936698	1,599,149 - 1,600,989 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	100,762,917 - 100,764,773 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	100,762,918 - 100,764,771 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	105,710,667 - 105,712,524 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MYF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	76,180,919 - 76,183,910 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	76,182,151 - 76,183,992 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	169,253,627 - 169,255,494 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Myf6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624837	24,775 - 25,973 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624837	24,711 - 29,217 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Myf6
14 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	173
Count of miRNA genes:	123
Interacting mature miRNAs:	139
Transcripts:	ENSRNOT00000006523
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	29409683	53612950	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	41109692	56793354	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat

Markers in Region

RH94559

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	42,813,187 - 42,813,353 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	49,739,823 - 49,739,988	NCBI	Rnor6.0
Rnor_5.0	7	49,749,731 - 49,749,896	UniSTS	Rnor5.0
RGSC_v3.4	7	46,200,149 - 46,200,314	UniSTS	RGSC3.4
Celera	7	39,685,784 - 39,685,949	UniSTS
Cytogenetic Map	7	q21	UniSTS

Myf6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	42,813,583 - 42,814,392 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	49,740,219 - 49,741,030	NCBI	Rnor6.0
Rnor_5.0	7	49,750,127 - 49,750,938	UniSTS	Rnor5.0
RGSC_v3.4	7	46,200,545 - 46,201,357	UniSTS	RGSC3.4
Celera	7	39,686,180 - 39,686,989	UniSTS
Cytogenetic Map	7	q21	UniSTS

MARC_21230-21231:1032890530:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	42,813,551 - 42,813,957 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	49,740,187 - 49,740,592	NCBI	Rnor6.0
Rnor_5.0	7	49,750,095 - 49,750,500	UniSTS	Rnor5.0
RGSC_v3.4	7	46,200,513 - 46,200,918	UniSTS	RGSC3.4
Celera	7	39,686,148 - 39,686,553	UniSTS
Cytogenetic Map	7	q21	UniSTS

Myf6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	42,813,586 - 42,814,006 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	49,740,222 - 49,740,641	NCBI	Rnor6.0
Rnor_5.0	7	49,750,130 - 49,750,549	UniSTS	Rnor5.0
RGSC_v3.4	7	46,200,548 - 46,200,967	UniSTS	RGSC3.4
Celera	7	39,686,183 - 39,686,602	UniSTS
Cytogenetic Map	7	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium						8	11					8
Low		5	2	3	2					6	7
Below cutoff	21	15	8	8	8			10	6	17	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M27151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M84685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006523 ⟹ ENSRNOP00000006523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	42,813,008 - 42,814,852 (-)	Ensembl
Rnor_6.0 Ensembl	7	49,739,646 - 49,741,540 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105234 ⟹ ENSRNOP00000084121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	42,812,792 - 42,814,852 (-)	Ensembl

RefSeq Acc Id:

NM_013172 ⟹ NP_037304

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	44,699,469 - 44,701,313 (-)	NCBI
mRatBN7.2	7	42,813,008 - 42,814,852 (-)	NCBI
Rnor_6.0	7	49,739,643 - 49,741,490 (-)	NCBI
Rnor_5.0	7	49,749,554 - 49,751,448 (-)	NCBI
RGSC_v3.4	7	46,199,972 - 46,201,867 (-)	RGD
Celera	7	39,685,604 - 39,687,449 (-)	NCBI

Sequence:

show sequence

GTCCATCACCCAGTTCAGATCAGTCAGAGGCCAAGGAGGAGAACATGATGATGGACCTTTTTGA
AACTGGCTCCTATTTCTTCTACTTAGATGGAGAAAATGTGACTCTTCAGCCATTAGAAGTGGCA
GAGGGCTCTCCTTTGTACCCAGGGAGTGATGGTACCCTATCCCCTTGCCAGGACCAAATGCCCC
AGGAAGCCGGGAGCGACAGCAGTGGAGAGGAACACGTTCTGGCTCCCCCAGGCCTTCAGCCACC
CCACTGCCCAGGTCAGTGTCTGATCTGGGCTTGCAAGACTTGCAAGAGAAAATCTGCCCCCACA
GATCGTCGGAAAGCAGCTACCCTGCGCGAAAGGAGGAGGCTTAAGAAAATCAACGAAGCCTTTG
AGGCCTTGAAGCGTAGAACTGTGGCCAACCCCAACCAGAGGCTGCCCAAGGTGGAGATTCTGAG
AAGTGCCATCAACTACATTGAGCGTCTGCAGGACCTGCTGCACCGGCTGGATCAGCAAGAGAAA
ATGCAGGAGCTGGGGGTGGACCCTTACAGCTACAAACCCAAGCAAGAAATTCTTGAGGGTGCGG
ATTTCCTGCGCACCTGCAGCCCGCAGTGGCCAAGTGTTTCGGATCATTCCAGGGGCCTGGTGAT
AACTGCTAAGGAAGGAGGAGCAAGCGTCGATGCTTCAGCCTCCAGCAGTCTTCAGCGCCTTTCT
TCCATCGTGGACAGTATTTCCTCAGAGGAACGCAAACTCCCCAGCGTGGAGGAGGTGGTGGAGA
AGTAACTCAGTCAGCATTTGGAACATTCTTCGCTCAGCAGGAAGAGCCCCTTTCCGCCTAATCA
TTTAGATTAGGGCTCACAGACCCCAGAATTTATGAAAGGCAAGAGACTTAGTGTTAAAAAAGAA
ACCTCTCCCCACCTCAAGTGAAAATCCTTCGGCTTGGGGCTTTTATTATAACTATTATTGTATC
TGAACCGCTAGTGGCTTAGCTCTAGAACCCTAATTTTGTTTTTAGTTTGGTTGGTTTTTTATAA
CATATTAACTTTTGCTATGATCACGTGACCCTTTCCTGTCAGTTGCAAACGAAGTTCATTCCTG
TCTAAATCAAAGTGGGAACGTTTAATCCTAAGAGTATTTAATGTACTTTTGTAAATAGTCTTAG
TACTTTCGTTTTTATGTAAACCTAAAGGACATATTTTAAATGTGGAATTAAGCATTGTATATAA
AATGTGTGAGAGTCTGATATTGTAATATTAAAATATTAATACGTTTCTACACGTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037304	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41635	(Get FASTA)	NCBI Sequence Viewer
	AAA41636	(Get FASTA)	NCBI Sequence Viewer
	EDM16768	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006523
	ENSRNOP00000006523.4
	ENSRNOP00000084121.1
	ENSRNOP00055023080
	ENSRNOP00060004840
	ENSRNOP00065003232
GenBank Protein	P19335	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037304 ⟸ NM_013172

- UniProtKB:

P19335 (UniProtKB/Swiss-Prot), A6IGD0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLA
PPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRL
PKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFLRTCSPQWPSVSD
HSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVVEK

hide sequence

RefSeq Acc Id:

ENSRNOP00000006523 ⟸ ENSRNOT00000006523

RefSeq Acc Id:

ENSRNOP00000084121 ⟸ ENSRNOT00000105234

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P19335-F1-model_v2	AlphaFold	P19335	1-242	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695181

Promoter ID:

EPDNEW_R5706

Type:

initiation region

Name:

Myf6_1

Description:

myogenic factor 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	49,741,532 - 49,741,592	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3134	AgrOrtholog
BioCyc Gene	G2FUF-34177	BioCyc
Ensembl Genes	ENSRNOG00000004878	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055016866	UniProtKB/Swiss-Prot
	ENSRNOG00060003872	UniProtKB/Swiss-Prot
	ENSRNOG00065003195	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006523	ENTREZGENE
	ENSRNOT00000006523.6	UniProtKB/Swiss-Prot
	ENSRNOT00000105234.1	UniProtKB/TrEMBL
	ENSRNOT00055028652	UniProtKB/Swiss-Prot
	ENSRNOT00060006465	UniProtKB/Swiss-Prot
	ENSRNOT00065004512	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Basic	UniProtKB/Swiss-Prot
	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MyoD_N	UniProtKB/TrEMBL
	Myogenic_factor	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25714	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25714	ENTREZGENE
PANTHER	MYOGENIC FACTOR 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11534	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Basic	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Myf6	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004878	RatGTEx
	ENSRNOG00055016866	RatGTEx
	ENSRNOG00060003872	RatGTEx
	ENSRNOG00065003195	RatGTEx
SMART	BASIC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC207024
UniProt	A0A8I6A0M5_RAT	UniProtKB/TrEMBL
	A6IGD0	ENTREZGENE, UniProtKB/TrEMBL
	MYF6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-11-06	Myf6	myogenic factor 6		Myogenic factor 6 (herculin)	Name updated	625702	APPROVED
2002-06-10	Myf6	Myogenic factor 6 (herculin)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in myotubes and young myofibers but absent from satellite cells	727338
gene_regulation	expression increases as the cells differentiate into myofibers	729255

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar