Symbol:
Map1b
Name:
microtubule-associated protein 1B
RGD ID:
3043
Description:
Enables actin binding activity; microtubule binding activity; and phospholipid binding activity. Involved in several processes, including nervous system development; positive regulation of cell differentiation; and regulation of microtubule polymerization or depolymerization. Located in several cellular components, including axon; dendrite; and perikaryon. Part of microtubule associated complex. Biomarker of hypothyroidism. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 83 and periventricular nodular heterotopia. Orthologous to human MAP1B (microtubule associated protein 1B); PARTICIPATES IN Reelin signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MAP-1B; Mtap1b; neuraxin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bp115
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 32,551,423 - 32,644,471 (-) NCBI GRCr8 mRatBN7.2 2 30,817,261 - 30,910,458 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 30,817,261 - 30,910,317 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 37,887,269 - 37,980,116 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 35,981,626 - 36,074,463 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 30,785,607 - 30,878,656 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 29,675,391 - 29,768,750 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 29,675,391 - 29,768,750 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 48,837,124 - 48,930,483 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 30,415,235 - 30,508,354 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 30,339,919 - 30,360,389 (-) NCBI Celera 2 26,841,920 - 26,934,955 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map1b Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MAP1B mRNA] CTD PMID:31150632 Map1b Rat 1,1-dichloroethene increases expression ISO Map1b (Mus musculus) 6480464 vinylidene chloride results in increased expression of MAP1B mRNA CTD PMID:26682919 Map1b Rat 1,2-dichloroethane affects expression ISO Map1b (Mus musculus) 6480464 ethylene dichloride affects the expression of MAP1B mRNA CTD PMID:28960355 Map1b Rat 1,2-dimethylhydrazine multiple interactions ISO Map1b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MAP1B mRNA CTD PMID:22206623 Map1b Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of MAP1B mRNA CTD PMID:30723492 Map1b Rat 17beta-estradiol increases expression ISO MAP1B (Homo sapiens) 6480464 Estradiol results in increased expression of MAP1B mRNA CTD PMID:20106945 and PMID:31614463 Map1b Rat 17beta-estradiol multiple interactions ISO MAP1B (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of MAP1B mRNA CTD PMID:30165855 Map1b Rat 17beta-estradiol decreases expression ISO MAP1B (Homo sapiens) 6480464 Estradiol results in decreased expression of MAP1B mRNA CTD PMID:19167446 Map1b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Map1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map1b Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Map1b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Map1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Map1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP1B mRNA CTD PMID:19933214 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP1B mRNA CTD PMID:33387578 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MAP1B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAP1B mRNA CTD PMID:21632981 and PMID:21802500 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP1B mRNA CTD PMID:21570461 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MAP1B mRNA CTD PMID:22298810 and PMID:34747641 Map1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MAP1B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP1B mRNA CTD PMID:20106945 Map1b Rat 2,5-hexanedione decreases expression EXP 6480464 2 more ... CTD PMID:20554699 and PMID:31760062 Map1b Rat 2-methylcholine affects expression ISO MAP1B (Homo sapiens) 6480464 beta-methylcholine affects the expression of MAP1B mRNA CTD PMID:21179406 Map1b Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MAP1B mRNA CTD PMID:30071829 Map1b Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of MAP1B mRNA and alpha-Chlorohydrin results in increased expression of MAP1B protein CTD PMID:28522335 and PMID:34915118 Map1b Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of MAP1B mRNA CTD PMID:19162173 Map1b Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MAP1B mRNA CTD PMID:30723492 Map1b Rat 4,4'-sulfonyldiphenol decreases methylation ISO Map1b (Mus musculus) 6480464 bisphenol S results in decreased methylation of MAP1B exon CTD PMID:33297965 Map1b Rat 4,4'-sulfonyldiphenol affects methylation ISO Map1b (Mus musculus) 6480464 bisphenol S affects the methylation of MAP1B gene CTD PMID:31683443 Map1b Rat 4,4'-sulfonyldiphenol increases methylation ISO MAP1B (Homo sapiens) 6480464 bisphenol S results in increased methylation of MAP1B gene CTD PMID:31601247 Map1b Rat 4-hydroxyphenyl retinamide increases expression ISO Map1b (Mus musculus) 6480464 Fenretinide results in increased expression of MAP1B mRNA CTD PMID:28973697 Map1b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MAP1B mRNA CTD PMID:24780913 Map1b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MAP1B mRNA CTD PMID:31881176 Map1b Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of MAP1B mRNA CTD PMID:23630614 and PMID:25378103 Map1b Rat aflatoxin B1 decreases methylation ISO MAP1B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MAP1B gene CTD PMID:27153756 Map1b Rat all-trans-retinoic acid decreases expression ISO MAP1B (Homo sapiens) 6480464 Tretinoin results in decreased expression of MAP1B mRNA CTD PMID:21934132 Map1b Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of MAP1B protein CTD PMID:16483693 Map1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MAP1B mRNA CTD PMID:16483693 Map1b Rat antimycin A decreases expression ISO MAP1B (Homo sapiens) 6480464 Antimycin A results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat antirheumatic drug increases expression ISO MAP1B (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of MAP1B mRNA CTD PMID:24449571 Map1b Rat aristolochic acid A decreases expression ISO MAP1B (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MAP1B mRNA CTD PMID:33212167 Map1b Rat arsane multiple interactions ISO MAP1B (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP1B mRNA CTD PMID:39836092 Map1b Rat arsenic atom multiple interactions ISO MAP1B (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP1B mRNA CTD PMID:39836092 Map1b Rat arsenite(3-) multiple interactions ISO MAP1B (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MAP1B protein] CTD PMID:32406909 Map1b Rat arsenous acid increases expression ISO MAP1B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAP1B mRNA CTD PMID:20458559 Map1b Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of MAP1B mRNA CTD PMID:36841081 Map1b Rat azathioprine increases expression ISO MAP1B (Homo sapiens) 6480464 Azathioprine results in increased expression of MAP1B mRNA CTD PMID:22623647 Map1b Rat azoxystrobin decreases expression ISO MAP1B (Homo sapiens) 6480464 azoxystrobin results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat benzo[a]pyrene increases expression ISO Map1b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAP1B mRNA CTD PMID:32417428 Map1b Rat benzo[a]pyrene increases expression ISO MAP1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MAP1B mRNA CTD PMID:35870112 Map1b Rat beta-lapachone increases expression ISO MAP1B (Homo sapiens) 6480464 beta-lapachone results in increased expression of MAP1B mRNA CTD PMID:38218311 Map1b Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of MAP1B mRNA CTD PMID:16648578 Map1b Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of MAP1B mRNA CTD PMID:20920545 Map1b Rat bis(2-ethylhexyl) phthalate increases expression ISO Map1b (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MAP1B mRNA CTD PMID:33754040 Map1b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAP1B mRNA CTD PMID:25181051 and PMID:30816183 Map1b Rat bisphenol A increases expression ISO MAP1B (Homo sapiens) 6480464 bisphenol A analog results in increased expression of MAP1B mRNA and bisphenol A results in increased expression of MAP1B protein CTD PMID:32387340 and PMID:34186270 Map1b Rat bisphenol A affects expression ISO MAP1B (Homo sapiens) 6480464 bisphenol A affects the expression of MAP1B mRNA CTD PMID:30903817 Map1b Rat bisphenol AF increases expression ISO MAP1B (Homo sapiens) 6480464 bisphenol AF results in increased expression of MAP1B protein CTD PMID:34186270 Map1b Rat Bisphenol B increases expression ISO MAP1B (Homo sapiens) 6480464 bisphenol B results in increased expression of MAP1B protein CTD PMID:34186270 Map1b Rat bisphenol F increases expression ISO MAP1B (Homo sapiens) 6480464 bisphenol F results in increased expression of MAP1B protein CTD PMID:34186270 Map1b Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of MAP1B protein CTD PMID:28903499 Map1b Rat butanal increases expression ISO MAP1B (Homo sapiens) 6480464 butyraldehyde results in increased expression of MAP1B mRNA CTD PMID:26079696 Map1b Rat cadmium atom increases expression ISO MAP1B (Homo sapiens) 6480464 Cadmium results in increased expression of MAP1B mRNA CTD PMID:21120746 and PMID:23369406 Map1b Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAP1B mRNA CTD PMID:33453195 Map1b Rat cadmium dichloride increases expression ISO MAP1B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat caffeine affects phosphorylation ISO MAP1B (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MAP1B protein CTD PMID:35688186 Map1b Rat cannabidiol increases expression ISO MAP1B (Homo sapiens) 6480464 Cannabidiol results in increased expression of MAP1B mRNA CTD PMID:27714895 and PMID:27918106 Map1b Rat carbon nanotube decreases expression ISO Map1b (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MAP1B protein CTD PMID:33892499 Map1b Rat CGP 52608 multiple interactions ISO MAP1B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAP1B gene] CTD PMID:28238834 Map1b Rat chlordecone multiple interactions ISO Map1b (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to MAP1B gene] CTD PMID:31084621 Map1b Rat clobetasol decreases expression ISO Map1b (Mus musculus) 6480464 Clobetasol results in decreased expression of MAP1B mRNA CTD PMID:27462272 Map1b Rat clozapine decreases expression ISO MAP1B (Homo sapiens) 6480464 Clozapine results in decreased expression of MAP1B protein CTD PMID:34122009 Map1b Rat cobalt dichloride increases expression ISO MAP1B (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAP1B mRNA CTD PMID:19376846 Map1b Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of MAP1B mRNA CTD PMID:20187946 Map1b Rat cocaine decreases expression ISO MAP1B (Homo sapiens) 6480464 Cocaine results in decreased expression of MAP1B mRNA CTD PMID:12629581 Map1b Rat copper atom multiple interactions ISO MAP1B (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAP1B mRNA CTD PMID:20971185 Map1b Rat copper(0) multiple interactions ISO MAP1B (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAP1B mRNA CTD PMID:20971185 Map1b Rat copper(II) chloride increases expression ISO MAP1B (Homo sapiens) 6480464 cupric chloride results in increased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat copper(II) sulfate increases expression ISO MAP1B (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAP1B mRNA CTD PMID:19549813 Map1b Rat coumarin affects phosphorylation ISO MAP1B (Homo sapiens) 6480464 coumarin affects the phosphorylation of MAP1B protein CTD PMID:35688186 Map1b Rat coumestrol decreases expression ISO MAP1B (Homo sapiens) 6480464 Coumestrol results in decreased expression of MAP1B mRNA CTD PMID:19167446 Map1b Rat coumestrol multiple interactions ISO MAP1B (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Map1b Rat CU-O LINKAGE affects phosphorylation ISO MAP1B (Homo sapiens) 6480464 cupric oxide affects the phosphorylation of MAP1B protein CTD PMID:25470785 Map1b Rat cyclosporin A increases expression ISO MAP1B (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAP1B mRNA CTD PMID:21632981 more ... Map1b Rat daunorubicin affects response to substance ISO MAP1B (Homo sapiens) 6480464 MAP1B affects the susceptibility to Daunorubicin CTD PMID:17545624 Map1b Rat DDE decreases expression ISO MAP1B (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat deguelin decreases expression ISO MAP1B (Homo sapiens) 6480464 deguelin results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of MAP1B mRNA CTD PMID:20032058 Map1b Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of MAP1B mRNA] CTD PMID:20032058 Map1b Rat diarsenic trioxide increases expression ISO MAP1B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MAP1B mRNA CTD PMID:20458559 Map1b Rat diazinon decreases expression ISO Map1b (Mus musculus) 6480464 Diazinon results in decreased expression of MAP1B protein CTD PMID:17239417 Map1b Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of MAP1B mRNA CTD PMID:21266533 Map1b Rat diiodine decreases expression EXP 6480464 Iodine deficiency results in decreased expression of MAP1B protein CTD PMID:27444543 Map1b Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of MAP1B mRNA CTD PMID:37567419 Map1b Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MAP1B mRNA CTD PMID:25152437 Map1b Rat dorsomorphin multiple interactions ISO MAP1B (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Map1b Rat doxorubicin affects expression ISO MAP1B (Homo sapiens) 6480464 Doxorubicin affects the expression of MAP1B protein CTD PMID:29385562 Map1b Rat doxorubicin decreases expression ISO MAP1B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAP1B mRNA CTD PMID:29803840 Map1b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MAP1B mRNA CTD PMID:29391264 Map1b Rat Enterolactone multiple interactions ISO MAP1B (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of MAP1B mRNA CTD PMID:19167446 Map1b Rat enzyme inhibitor multiple interactions ISO MAP1B (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MAP1B protein CTD PMID:23301498 Map1b Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of MAP1B mRNA CTD PMID:17618662 Map1b Rat ethanol affects splicing ISO Map1b (Mus musculus) 6480464 Ethanol affects the splicing of MAP1B mRNA CTD PMID:30319688 Map1b Rat ethanol multiple interactions EXP 6480464 [Dronabinol co-treated with Ethanol] results in increased expression of MAP1B mRNA CTD PMID:17618662 Map1b Rat fenpyroximate decreases expression ISO MAP1B (Homo sapiens) 6480464 fenpyroximate results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of MAP1B mRNA CTD PMID:31881178 Map1b Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of MAP1B mRNA CTD PMID:17033635 Map1b Rat folic acid affects expression ISO MAP1B (Homo sapiens) 6480464 Folic Acid affects the expression of MAP1B mRNA CTD PMID:17320366 Map1b Rat folic acid increases expression ISO Map1b (Mus musculus) 6480464 Folic Acid results in increased expression of MAP1B mRNA CTD PMID:25629700 Map1b Rat folic acid multiple interactions ISO Map1b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of MAP1B mRNA CTD PMID:22206623 Map1b Rat FR900359 affects phosphorylation ISO MAP1B (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MAP1B protein CTD PMID:37730182 Map1b Rat geldanamycin increases expression ISO MAP1B (Homo sapiens) 6480464 geldanamycin results in increased expression of MAP1B mRNA CTD PMID:26705709 Map1b Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of MAP1B gene CTD PMID:31011160 Map1b Rat gold atom increases expression ISO MAP1B (Homo sapiens) 6480464 Gold results in increased expression of MAP1B mRNA CTD PMID:29705079 Map1b Rat gold(0) increases expression ISO MAP1B (Homo sapiens) 6480464 Gold results in increased expression of MAP1B mRNA CTD PMID:29705079 Map1b Rat hydrogen peroxide multiple interactions ISO Map1b (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Map1b Rat hydroquinone increases expression ISO MAP1B (Homo sapiens) 6480464 hydroquinone results in increased expression of MAP1B mRNA CTD PMID:31256213 Map1b Rat ivermectin decreases expression ISO MAP1B (Homo sapiens) 6480464 Ivermectin results in decreased expression of MAP1B protein CTD PMID:32959892 Map1b Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of MAP1B mRNA CTD PMID:20080153 Map1b Rat lead diacetate increases expression ISO MAP1B (Homo sapiens) 6480464 lead acetate results in increased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat leflunomide increases expression ISO MAP1B (Homo sapiens) 6480464 leflunomide results in increased expression of MAP1B mRNA CTD PMID:28988120 Map1b Rat lipopolysaccharide increases expression ISO MAP1B (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MAP1B mRNA CTD PMID:35811015 Map1b Rat lipopolysaccharide multiple interactions ISO MAP1B (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Map1b Rat methylmercury chloride increases expression ISO MAP1B (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MAP1B mRNA CTD PMID:23179753 and PMID:26272509 Map1b Rat methylmercury chloride multiple interactions ISO MAP1B (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP1B mRNA CTD PMID:27188386 Map1b Rat methylseleninic acid affects expression ISO MAP1B (Homo sapiens) 6480464 methylselenic acid affects the expression of MAP1B mRNA CTD PMID:14617803 Map1b Rat methylseleninic acid increases expression ISO MAP1B (Homo sapiens) 6480464 methylselenic acid results in increased expression of MAP1B mRNA CTD PMID:18548127 Map1b Rat miconazole decreases expression ISO Map1b (Mus musculus) 6480464 Miconazole results in decreased expression of MAP1B mRNA CTD PMID:27462272 Map1b Rat mifepristone increases expression ISO MAP1B (Homo sapiens) 6480464 Mifepristone results in increased expression of MAP1B mRNA CTD PMID:17584828 Map1b Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of MAP1B mRNA CTD PMID:16809437 Map1b Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of MAP1B gene CTD PMID:33148267 Map1b Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Map1b (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of MAP1B mRNA CTD PMID:25566086 Map1b Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Map1b (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of MAP1B mRNA] CTD PMID:25566086 Map1b Rat paracetamol increases expression ISO MAP1B (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAP1B mRNA CTD PMID:21420995 and PMID:29067470 Map1b Rat PCB138 multiple interactions ISO Map1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Map1b Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:21673325 Map1b Rat perfluorooctanoic acid increases expression ISO MAP1B (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MAP1B protein CTD PMID:26879310 Map1b Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of MAP1B gene CTD PMID:33148267 Map1b Rat phenylmercury acetate increases expression ISO MAP1B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MAP1B mRNA CTD PMID:26272509 Map1b Rat phenylmercury acetate multiple interactions ISO MAP1B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP1B mRNA CTD PMID:27188386 Map1b Rat phenytoin increases expression ISO MAP1B (Homo sapiens) 6480464 Phenytoin results in increased expression of MAP1B mRNA CTD PMID:14741686 Map1b Rat potassium chromate decreases expression ISO MAP1B (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MAP1B mRNA CTD PMID:22714537 Map1b Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of MAP1B mRNA CTD PMID:20726854 Map1b Rat propanal increases expression ISO MAP1B (Homo sapiens) 6480464 propionaldehyde results in increased expression of MAP1B mRNA CTD PMID:26079696 Map1b Rat pyrimidifen decreases expression ISO MAP1B (Homo sapiens) 6480464 pyrimidifen results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat quercetin increases expression ISO MAP1B (Homo sapiens) 6480464 Quercetin results in increased expression of MAP1B mRNA CTD PMID:21632981 Map1b Rat resveratrol multiple interactions ISO MAP1B (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in decreased expression of MAP1B mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of MAP1B mRNA CTD PMID:19167446 and PMID:23557933 Map1b Rat resveratrol decreases expression ISO MAP1B (Homo sapiens) 6480464 resveratrol results in decreased expression of MAP1B mRNA CTD PMID:19167446 Map1b Rat rotenone decreases expression ISO MAP1B (Homo sapiens) 6480464 Rotenone results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MAP1B (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Map1b Rat SB 431542 multiple interactions ISO MAP1B (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Map1b Rat silicon dioxide increases expression ISO MAP1B (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MAP1B mRNA CTD PMID:25895662 Map1b Rat sodium arsenate increases expression ISO Map1b (Mus musculus) 6480464 sodium arsenate results in increased expression of MAP1B mRNA CTD PMID:21795629 Map1b Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MAP1B protein CTD PMID:29459688 Map1b Rat sodium arsenite multiple interactions ISO MAP1B (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP1B mRNA CTD PMID:39836092 Map1b Rat sodium arsenite decreases expression ISO MAP1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MAP1B mRNA CTD PMID:34032870 Map1b Rat sodium arsenite increases expression ISO MAP1B (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat sulforaphane decreases expression ISO MAP1B (Homo sapiens) 6480464 sulforaphane results in decreased expression of MAP1B mRNA CTD PMID:31838189 Map1b Rat sunitinib increases expression ISO MAP1B (Homo sapiens) 6480464 Sunitinib results in increased expression of MAP1B mRNA CTD PMID:31533062 Map1b Rat T-2 toxin decreases expression ISO MAP1B (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of MAP1B mRNA CTD PMID:34581912 Map1b Rat tebufenpyrad decreases expression ISO MAP1B (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of MAP1B mRNA CTD PMID:33512557 Map1b Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of MAP1B mRNA] CTD PMID:20032058 Map1b Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MAP1B mRNA] CTD PMID:31150632 Map1b Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of MAP1B mRNA CTD PMID:31150632 Map1b Rat tetrahydropalmatine increases expression ISO MAP1B (Homo sapiens) 6480464 tetrahydropalmatine results in increased expression of MAP1B protein CTD PMID:20109541 Map1b Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of MAP1B protein CTD PMID:35544339 Map1b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAP1B mRNA CTD PMID:23411599 and PMID:34492290 Map1b Rat thiram increases expression ISO MAP1B (Homo sapiens) 6480464 Thiram results in increased expression of MAP1B mRNA CTD PMID:38568856 Map1b Rat titanium dioxide decreases methylation ISO Map1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP1B gene and titanium dioxide results in decreased methylation of MAP1B promoter CTD PMID:35295148 Map1b Rat trichloroethene decreases phosphorylation ISO MAP1B (Homo sapiens) 6480464 Trichloroethylene results in decreased phosphorylation of MAP1B protein CTD PMID:26018768 Map1b Rat valproic acid increases expression ISO MAP1B (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAP1B mRNA CTD PMID:23179753 more ... Map1b Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of MAP1B mRNA CTD PMID:29427782 Map1b Rat valproic acid affects expression ISO MAP1B (Homo sapiens) 6480464 Valproic Acid affects the expression of MAP1B mRNA CTD PMID:25979313 Map1b Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MAP1B mRNA CTD PMID:19015723 Map1b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MAP1B mRNA CTD PMID:23034163 Map1b Rat vorinostat decreases expression ISO MAP1B (Homo sapiens) 6480464 vorinostat results in decreased expression of MAP1B mRNA CTD PMID:27188386 Map1b Rat xylitol increases expression ISO MAP1B (Homo sapiens) 6480464 Xylitol results in increased expression of MAP1B mRNA CTD PMID:32275922
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) azathioprine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) clobetasol (ISO) clozapine (ISO) cobalt dichloride (ISO) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) daunorubicin (ISO) DDE (ISO) deguelin (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) diazinon (ISO) dibutyl phthalate (EXP) diiodine (EXP) dimethylarsinic acid (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) fenpyroximate (ISO) fipronil (EXP) fluoxetine (EXP) folic acid (ISO) FR900359 (ISO) geldanamycin (ISO) glyphosate (EXP) gold atom (ISO) gold(0) (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) ivermectin (ISO) ketamine (EXP) lead diacetate (ISO) leflunomide (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) miconazole (ISO) mifepristone (ISO) mono(2-ethylhexyl) phthalate (EXP) N,N-diethyl-m-toluamide (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) paracetamol (ISO) PCB138 (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) phenytoin (ISO) potassium chromate (ISO) progesterone (EXP) propanal (ISO) pyrimidifen (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (ISO) tebufenpyrad (ISO) testosterone (EXP) tetrachloromethane (EXP) tetrahydropalmatine (ISO) thapsigargin (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO) xylitol (ISO)
Biological Process
axon extension (IEA,ISO) axonogenesis (IBA,IEA,ISO) cellular response to growth factor stimulus (IEP) cellular response to peptide hormone stimulus (IEP) dendrite development (IBA,IEA,ISO) developmental maturation (IEP) establishment of monopolar cell polarity (IEA,ISO) induction of synaptic plasticity by chemical substance (IEP) intracellular transport (IEA,ISO) microtubule bundle formation (IDA,IEA,ISO) microtubule cytoskeleton organization (IBA,IEA) mitochondrion transport along microtubule (IEA,ISO) negative regulation of intracellular transport (IEA,ISO) negative regulation of microtubule depolymerization (IDA) nervous system development (IEP) neuron development (IEP) neuron projection development (IEA,ISO,ISS) odontoblast differentiation (IEA,ISO) peripheral nervous system axon regeneration (IEP) positive regulation of axon extension (IMP) positive regulation of microtubule polymerization (IDA) positive regulation of neuron differentiation (IMP) regulation of microtubule depolymerization (IBA) regulation of postsynapse assembly (IEA,ISO) response to axon injury (IEP) response to carbohydrate (IEP) response to estradiol (IEP) response to insecticide (IEP) response to mechanical stimulus (IEP) response to nutrient levels (IEP) response to vitamin A (IEP) response to xenobiotic stimulus (IEP) synapse assembly (IEP)
Cellular Component
apical dendrite (IDA) axon (IDA) basal dendrite (IDA) cell projection (IEA) cytoplasm (IEA) cytoskeleton (IEA) cytosol (IBA,IEA,ISO) dendrite (IBA,IDA,IEA,ISO) dendritic spine (IEA) glutamatergic synapse (IEA,ISO) growth cone (IDA) hippocampal mossy fiber (IDA) microtubule (IBA,IDA,IEA) microtubule associated complex (IBA,IDA) microtubule cytoskeleton (IEA) neuronal cell body (IBA,IDA,IEA,ISO) perikaryon (IDA) perinuclear region of cytoplasm (IDA) photoreceptor outer segment (IEA,ISO) plasma membrane (IEA,ISO) postsynapse (IEA,ISO) postsynaptic density (IEA,ISO) somatodendritic compartment (IDA) synapse (IBA,IEA) varicosity (IDA)
1.
Neuronal differentiation of adult rat hippocampus-derived neural stem cells transplanted into embryonic rat explanted retinas with retinoic acid pretreatment.
Akita J, etal., Brain Res. 2002 Nov 8;954(2):286-93.
2.
Effect of hypothyroidism on the expression of three microtubule-associated proteins (1A, 1B and 2) in developing rat cerebellum.
Benjamin S, etal., Neuroscience. 1988 Dec;27(3):931-9.
3.
Agrin induced morphological and structural changes in growth cones of cultured hippocampal neurons.
Bergstrom RA, etal., Neuroscience. 2007 Nov 9;149(3):527-36. Epub 2007 Aug 14.
4.
Microtubule-associated protein 1B-light chain 1 enhances activation of Rap1 by exchange protein activated by cyclic AMP but not intracellular targeting.
Borland G, etal., Mol Pharmacol. 2006 Jan;69(1):374-84. Epub 2005 Oct 21.
5.
Attenuation of microtubule-associated protein 1B expression by antisense oligodeoxynucleotides inhibits initiation of neurite outgrowth.
Brugg B, etal., Neuroscience. 1993 Feb;52(3):489-96.
6.
MAP-1B/TAU functional redundancy during laminin-enhanced axonal growth.
DiTella MC, etal., J Cell Sci. 1996 Feb;109 ( Pt 2):467-77.
7.
Neuronal abnormalities in microtubule-associated protein 1B mutant mice.
Edelmann W, etal., Proc Natl Acad Sci U S A 1996 Feb 6;93(3):1270-5.
8.
Bilateral growth-related protein expression suggests a transient increase in regenerative potential following brain trauma.
Emery DL, etal., J Comp Neurol. 2000 Aug 28;424(3):521-31.
9.
Regenerating sciatic nerve axons contain the adult rather than the embryonic pattern of microtubule associated proteins.
Fawcett JW, etal., Neuroscience. 1994 Aug;61(4):789-804.
10.
Synaptic plasticity is preserved in the temporal cortex of 20-month-old rats.
Fischer B and Wagner AP, Arch Gerontol Geriatr. 1997 Jul-Aug;25(1):27-39.
11.
Intracerebral injection of AMPA causes axonal damage in vivo.
Fowler JH, etal., Brain Res. 2003 Nov 21;991(1-2):104-12.
12.
Microtubule-associated protein 1B: a neuronal binding partner for myelin-associated glycoprotein.
Franzen R, etal., J Cell Biol. 2001 Dec 10;155(6):893-8. Epub 2001 Dec 3.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Regulation of phosphorylation of neuronal microtubule-associated proteins MAP1b and MAP2 by protein phosphatase-2A and -2B in rat brain.
Gong CX, etal., Brain Res. 2000 Jan 24;853(2):299-309.
16.
Maternal protein restriction early in rat pregnancy alters brain development in the progeny.
Gressens P, etal., Brain Res Dev Brain Res. 1997 Oct 20;103(1):21-35.
17.
MAP2 Defines a Pre-axonal Filtering Zone to Regulate KIF1- versus KIF5-Dependent Cargo Transport in Sensory Neurons.
Gumy LF, etal., Neuron. 2017 Apr 19;94(2):347-362.e7. doi: 10.1016/j.neuron.2017.03.046.
18.
Localization of microtubule-associated protein (MAP) 1B in the postsynaptic densities of the rat cerebral cortex.
Kawakami S, etal., Cell Mol Neurobiol. 2003 Dec;23(6):887-94.
19.
Direct interaction and functional coupling between human 5-HT6 receptor and the light chain 1 subunit of the microtubule-associated protein 1B (MAP1B-LC1).
Kim SH, etal., PLoS One. 2014 Mar 10;9(3):e91402. doi: 10.1371/journal.pone.0091402. eCollection 2014.
20.
Changes in the subcellular distribution of microtubule-associated protein 1B during synaptogenesis of cultured rat cortical neurons.
Kitamura C, etal., Cell Mol Neurobiol. 2007 Feb;27(1):57-73. Epub 2006 Dec 7.
21.
BMP enhances transcriptional responses to NGF during PC12 cell differentiation.
Lonn P, etal., Neurochem Res. 2005 Jun-Jul;30(6-7):753-65.
22.
Differential regulation of microtubule-associated protein 1B (MAP1B) in rat CNS and PNS during development.
Ma D, etal., J Neurosci Res. 1997 Aug 1;49(3):319-32.
23.
Regulation of the expression and phosphorylation of microtubule-associated protein 1B during regeneration of adult dorsal root ganglion neurons.
Ma D, etal., Neuroscience. 2000;99(1):157-70.
24.
Molecular characterization of light chain 3. A microtubule binding subunit of MAP1A and MAP1B.
Mann SS and Hammarback JA, J Biol Chem 1994 Apr 15;269(15):11492-7.
25.
Agrin differentially regulates the rates of axonal and dendritic elongation in cultured hippocampal neurons.
Mantych KB and Ferreira A, J Neurosci. 2001 Sep 1;21(17):6802-9.
26.
Distribution and gene expression of cytoskeletal proteins in two-cell rat embryos and developmental arrest.
Matsumoto H, etal., J Exp Zool. 2002 Dec 1;293(7):641-8.
27.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
28.
Different postischemic protein expression of the GABA(A) receptor alpha2 subunit and the plasticity-associated protein MAP1B after treatment with BDNF versus G-CSF in the rat brain.
Muller HD, etal., Restor Neurol Neurosci. 2009;27(1):27-39.
29.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
30.
Microtubule-associated protein 1A (MAP1A) and MAP1B: light chains determine distinct functional properties.
Noiges R, etal., J Neurosci 2002 Mar 15;22(6):2106-14.
31.
Neuronal loss and cytoskeletal disruption following intrahippocampal administration of the metabolic inhibitor malonate: lack of protection by MK-801.
Pang Z, etal., J Neurochem. 1996 Feb;66(2):474-84.
32.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
Inhibition of extension outgrowth in differentiating rat C6 glioma cells by chlorpyrifos and chlorpyrifos oxon: effects on microtubule proteins.
Sachana M, etal., Toxicol In Vitro. 2008 Aug;22(5):1387-91. Epub 2008 Mar 18.
37.
Kindling status in sprague-dawley rats induced by pentylenetetrazole: involvement of a critical development period.
Schmoll H, etal., Am J Pathol. 2003 Mar;162(3):1027-34.
38.
Dynamics of gene expression for immediate early- and late genes after seizure activity in aged rats.
Schmoll H, etal., Arch Gerontol Geriatr. 2001 Jun;32(3):199-218.
39.
MAP 1A and MAP 1B are structurally related microtubule associated proteins with distinct developmental patterns in the CNS.
Schoenfeld TA, etal., J Neurosci. 1989 May;9(5):1712-30.
40.
Estrogen-induced changes in the microtubular system correlate with a decreased susceptibility of aging neurons to beta amyloid neurotoxicity.
Shah RD, etal., Mol Cell Neurosci. 2003 Oct;24(2):503-16.
41.
Segment-specific decrease of both catecholamine concentration and acetylcholinesterase activity are accompanied by nerve refinement in the rat cauda epididymis during sexual maturation.
Silva AM, etal., J Androl. 2002 May-Jun;23(3):374-83.
42.
Extensive structural remodeling of the injured spinal cord revealed by phosphorylated MAP1B in sprouting axons and degenerating neurons.
Soares S, etal., Eur J Neurosci. 2007 Sep;26(6):1446-61.
43.
Angiotensin II and NGF differentially influence microtubule proteins in PC12W cells: role of the AT2 receptor.
Stroth U, etal., Brain Res Mol Brain Res. 1998 Jan;53(1-2):187-95.
44.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
45.
Dynamic Palmitoylation Targets MAP6 to the Axon to Promote Microtubule Stabilization during Neuronal Polarization.
Tortosa E, etal., Neuron. 2017 May 17;94(4):809-825.e7. doi: 10.1016/j.neuron.2017.04.042.
46.
Panaxynol induces neurite outgrowth in PC12D cells via cAMP- and MAP kinase-dependent mechanisms.
Wang ZJ, etal., Chem Biol Interact. 2006 Jan 5;159(1):58-64. Epub 2005 Oct 10.
47.
Specific binding of acidic phospholipids to microtubule-associated protein MAP1B regulates its interaction with tubulin.
Yamauchi E, etal., J Biol Chem. 1997 Sep 5;272(36):22948-53.
48.
Identification of two distinct microtubule binding domains on recombinant rat MAP 1B.
Zauner W, etal., Eur J Cell Biol 1992 Feb;57(1):66-74.
Map1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 32,551,423 - 32,644,471 (-) NCBI GRCr8 mRatBN7.2 2 30,817,261 - 30,910,458 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 30,817,261 - 30,910,317 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 37,887,269 - 37,980,116 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 35,981,626 - 36,074,463 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 30,785,607 - 30,878,656 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 29,675,391 - 29,768,750 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 29,675,391 - 29,768,750 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 48,837,124 - 48,930,483 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 30,415,235 - 30,508,354 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 30,339,919 - 30,360,389 (-) NCBI Celera 2 26,841,920 - 26,934,955 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
MAP1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 72,107,475 - 72,209,565 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 72,107,234 - 72,209,565 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 71,403,302 - 71,505,392 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 71,438,874 - 71,541,153 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 71,515,074 - 71,538,609 NCBI Celera 5 67,298,553 - 67,400,783 (+) NCBI Celera Cytogenetic Map 5 q13.2 NCBI HuRef 5 66,608,550 - 66,710,969 (+) NCBI HuRef CHM1_1 5 70,835,805 - 70,938,065 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 72,588,652 - 72,690,733 (+) NCBI T2T-CHM13v2.0
Map1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 99,557,972 - 99,653,110 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 99,557,954 - 99,653,048 (-) Ensembl GRCm39 Ensembl GRCm38 13 99,421,464 - 99,516,602 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 99,421,446 - 99,516,540 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 100,191,419 - 100,286,557 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 100,524,598 - 100,616,697 (-) NCBI MGSCv36 mm8 Celera 13 103,077,104 - 103,171,785 (-) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 52.9 NCBI
Map1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955575 913,723 - 1,021,028 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955575 914,607 - 1,020,971 (+) NCBI ChiLan1.0 ChiLan1.0
MAP1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 43,104,167 - 43,206,535 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 41,257,795 - 41,360,140 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 43,102,739 - 43,204,978 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 43,701,530 - 43,803,393 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 43,701,530 - 43,803,393 (-) Ensembl panpan1.1 panPan2
MAP1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 55,175,000 - 55,258,160 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 55,174,837 - 55,253,975 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 52,143,740 - 52,226,846 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 55,691,610 - 55,774,703 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 55,691,446 - 55,771,854 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 52,751,922 - 52,834,958 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 53,519,445 - 53,602,504 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 54,410,527 - 54,493,742 (+) NCBI UU_Cfam_GSD_1.0
Map1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 186,487,418 - 186,592,600 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936549 4,266,351 - 4,371,644 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936549 4,266,371 - 4,371,579 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 48,403,568 - 48,498,885 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 48,403,338 - 48,501,453 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 52,391,814 - 52,489,652 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP1B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 66,445,687 - 66,548,595 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 66,445,901 - 66,549,142 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 15,202,185 - 15,305,303 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map1b
.
Predicted Target Of
Count of predictions: 570 Count of miRNA genes: 277 Interacting mature miRNAs: 358 Transcripts: ENSRNOT00000023460 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
X51396
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 32,554,812 - 32,554,915 (+) Marker Load Pipeline mRatBN7.2 2 30,820,649 - 30,820,753 (+) MAPPER mRatBN7.2 Rnor_6.0 2 29,678,780 - 29,678,883 NCBI Rnor6.0 Rnor_5.0 2 48,840,513 - 48,840,616 UniSTS Rnor5.0 RGSC_v3.4 2 30,418,624 - 30,418,727 UniSTS RGSC3.4 Celera 2 26,845,309 - 26,845,412 UniSTS Cytogenetic Map 2 q12 UniSTS
Mtap1b
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 30,910,018 - 30,910,198 (+) MAPPER mRatBN7.2 Rnor_6.0 2 29,768,452 - 29,768,631 NCBI Rnor6.0 Rnor_5.0 2 48,930,185 - 48,930,364 UniSTS Rnor5.0 RGSC_v3.4 2 30,508,056 - 30,508,235 UniSTS RGSC3.4 Celera 2 26,934,657 - 26,934,836 UniSTS Cytogenetic Map 2 q12 UniSTS
RH137448
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 30,896,129 - 30,896,339 (+) MAPPER mRatBN7.2 Rnor_6.0 2 29,754,567 - 29,754,776 NCBI Rnor6.0 Rnor_5.0 2 48,916,300 - 48,916,509 UniSTS Rnor5.0 RGSC_v3.4 2 30,494,171 - 30,494,380 UniSTS RGSC3.4 Celera 2 26,920,770 - 26,920,979 UniSTS Cytogenetic Map 2 q12 UniSTS
UniSTS:143928
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 30,826,822 - 30,827,027 (+) MAPPER mRatBN7.2 Rnor_6.0 2 29,684,953 - 29,685,157 NCBI Rnor6.0 Rnor_5.0 2 48,846,686 - 48,846,890 UniSTS Rnor5.0 RGSC_v3.4 2 30,424,797 - 30,425,001 UniSTS RGSC3.4 Celera 2 26,851,483 - 26,851,687 UniSTS Cytogenetic Map 2 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023460 ⟹ ENSRNOP00000023460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 30,817,261 - 30,910,317 (-) Ensembl Rnor_6.0 Ensembl 2 29,675,391 - 29,768,750 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103521 ⟹ ENSRNOP00000082357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 30,817,279 - 30,910,317 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113536 ⟹ ENSRNOP00000079012
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 30,817,261 - 30,910,317 (-) Ensembl
RefSeq Acc Id:
NM_019217 ⟹ NP_062090
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 32,551,423 - 32,644,471 (-) NCBI mRatBN7.2 2 30,817,261 - 30,910,317 (-) NCBI Rnor_6.0 2 29,675,391 - 29,768,750 (-) NCBI Rnor_5.0 2 48,837,124 - 48,930,483 (-) NCBI RGSC_v3.4 2 30,415,235 - 30,508,354 (-) RGD Celera 2 26,841,920 - 26,934,955 (-) RGD
Sequence:
CGCGCAGGGAGAGAGCGGAGGGGGAGGCGACGCGCGCCGGGAGGAGGGGGGACGCAGTGGGCGGAGCGGAGACAGCACCTTCGGAGATAATCCTTTCTCCTGCCGCAGAGCAGAGGAGCGGCGGGAGA
hide sequence
RefSeq Acc Id:
XM_039101889 ⟹ XP_038957817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 32,551,441 - 32,579,474 (-) NCBI mRatBN7.2 2 30,817,279 - 30,845,316 (-) NCBI
RefSeq Acc Id:
NP_062090 ⟸ NM_019217
- UniProtKB:
Q9QW92 (UniProtKB/Swiss-Prot), Q9ER21 (UniProtKB/Swiss-Prot), Q62958 (UniProtKB/Swiss-Prot), F1LRL9 (UniProtKB/Swiss-Prot), B0BNK3 (UniProtKB/Swiss-Prot), P15205 (UniProtKB/Swiss-Prot)
- Sequence:
MATVVVEATEPEPSGSIGNPAATTSPSLSHRFLDSKFYLLVVVGETVTEEHLRRAIGNIELGIRSWDTNLIECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMI
hide sequence
Ensembl Acc Id:
ENSRNOP00000023460 ⟸ ENSRNOT00000023460
RefSeq Acc Id:
XP_038957817 ⟸ XM_039101889
- Peptide Label:
isoform X1
- UniProtKB:
Q9QW92 (UniProtKB/Swiss-Prot), Q9ER21 (UniProtKB/Swiss-Prot), Q62958 (UniProtKB/Swiss-Prot), P15205 (UniProtKB/Swiss-Prot), F1LRL9 (UniProtKB/Swiss-Prot), B0BNK3 (UniProtKB/Swiss-Prot), A6I569 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082357 ⟸ ENSRNOT00000103521
Ensembl Acc Id:
ENSRNOP00000079012 ⟸ ENSRNOT00000113536
RGD ID: 13691098 Promoter ID: EPDNEW_R1623 Type: multiple initiation site Name: Map1b_1 Description: microtubule-associated protein 1B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 29,768,644 - 29,768,704 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-08-29
Map1b
microtubule-associated protein 1B
Mtap1b
microtubule-associated protein 1B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-21
Mtap1b
microtubule-associated protein 1B
Map1b
microtubule-associated protein 1b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Map1b
microtubule-associated protein 1b
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
contains two seperate microtubule binding domains one of which consists of basic repeat motif KKEE(I/V)
69879
