Symbol:
Sparcl1
Name:
SPARC like 1
RGD ID:
2531
Description:
Predicted to enable calcium ion binding activity; collagen binding activity; and extracellular matrix binding activity. Involved in regulation of synapse organization. Is active in extracellular matrix of synaptic cleft and glutamatergic synapse. Orthologous to human SPARCL1 (SPARC like 1); INTERACTS WITH (+)-pilocarpine; 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ecm2; Extracellular matrix protein 2; matrix glycoprotein Sc1; Sc1; SPARC-like 1; SPARC-like 1 (hevin); SPARC-like 1 (mast9, hevin); SPARC-like protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SPARCL1 (SPARC like 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Sparcl1 (SPARC-like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sparcl1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SPARCL1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HSD17B11 (hydroxysteroid 17-beta dehydrogenase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sparcl1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SPARCL1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SPARCL1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sparcl1 (SPARC like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SPARCL1 (SPARC like 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sparcl1 (SPARC-like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sparcl1 (SPARC-like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ost-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
SPARC
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 5,937,484 - 5,968,532 (+) NCBI GRCr8 mRatBN7.2 14 5,632,816 - 5,663,866 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 5,632,569 - 5,663,865 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 5,601,783 - 5,632,794 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 6,902,017 - 6,933,024 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 5,600,631 - 5,631,801 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 6,994,261 - 7,025,309 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 6,994,190 - 7,025,308 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 6,985,394 - 7,016,296 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 6,766,347 - 6,797,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 6,766,346 - 6,797,580 (+) NCBI Celera 14 5,771,812 - 5,802,805 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sparcl1 Rat (+)-pilocarpine affects localization EXP 6480464 Pilocarpine affects the localization of SPARCL1 protein CTD PMID:18488994 Sparcl1 Rat (+)-pilocarpine decreases expression EXP 6480464 Pilocarpine results in decreased expression of SPARCL1 protein CTD PMID:18808451 Sparcl1 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of SPARCL1 protein CTD PMID:17337753 Sparcl1 Rat 1,2-dimethylhydrazine multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of SPARCL1 mRNA CTD PMID:22206623 Sparcl1 Rat 17alpha-ethynylestradiol increases expression ISO Sparcl1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SPARCL1 mRNA CTD PMID:17942748 Sparcl1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of SPARCL1 mRNA CTD PMID:15576828 more ... Sparcl1 Rat 17alpha-ethynylestradiol multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPARCL1 mRNA CTD PMID:17942748 Sparcl1 Rat 17beta-estradiol multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SPARCL1 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of SPARCL1 mRNA CTD PMID:17404688 and PMID:20660070 Sparcl1 Rat 17beta-estradiol decreases expression ISO Sparcl1 (Mus musculus) 6480464 Estradiol results in decreased expression of SPARCL1 mRNA CTD PMID:39298647 Sparcl1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SPARCL1 mRNA CTD PMID:32145629 Sparcl1 Rat 17beta-estradiol decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Estradiol results in decreased expression of SPARCL1 mRNA CTD PMID:20106945 Sparcl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SPARCL1 mRNA CTD PMID:20106945 Sparcl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SPARCL1 mRNA CTD PMID:34747641 Sparcl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SPARCL1 mRNA CTD PMID:20959002 Sparcl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SPARCL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SPARCL1 mRNA CTD PMID:22298810 Sparcl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SPARCL1 mRNA CTD PMID:17942748 Sparcl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO SPARCL1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Sparcl1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Sparcl1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Sparcl1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SPARCL1 mRNA CTD PMID:21346803 Sparcl1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:20959002 Sparcl1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of SPARCL1 mRNA CTD PMID:28522335 Sparcl1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SPARCL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SPARCL1 mRNA CTD PMID:28628672 Sparcl1 Rat 3-methylcholanthrene decreases expression ISO Sparcl1 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of SPARCL1 mRNA CTD PMID:20713471 Sparcl1 Rat 4,4'-sulfonyldiphenol increases expression ISO Sparcl1 (Mus musculus) 6480464 bisphenol S results in increased expression of SPARCL1 mRNA CTD PMID:30951980 Sparcl1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Sparcl1 (Mus musculus) 6480464 bisphenol S affects the methylation of SPARCL1 gene CTD PMID:31683443 Sparcl1 Rat 4,4'-sulfonyldiphenol affects expression ISO Sparcl1 (Mus musculus) 6480464 bisphenol S affects the expression of SPARCL1 mRNA CTD PMID:39298647 Sparcl1 Rat 4-hydroxyphenyl retinamide increases expression ISO Sparcl1 (Mus musculus) 6480464 Fenretinide results in increased expression of SPARCL1 mRNA CTD PMID:28973697 Sparcl1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SPARCL1 mRNA CTD PMID:18077114 Sparcl1 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:19480007 Sparcl1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SPARCL1 mRNA CTD PMID:31881176 Sparcl1 Rat acrylamide decreases expression ISO Sparcl1 (Mus musculus) 6480464 Acrylamide results in decreased expression of SPARCL1 mRNA CTD PMID:30807115 Sparcl1 Rat aflatoxin B1 affects expression ISO SPARCL1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SPARCL1 protein CTD PMID:20106945 Sparcl1 Rat aflatoxin B1 decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SPARCL1 mRNA CTD PMID:22100608 more ... Sparcl1 Rat all-trans-retinoic acid decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SPARCL1 mRNA CTD PMID:21934132 Sparcl1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SPARCL1 mRNA CTD PMID:16483693 Sparcl1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SPARCL1 mRNA CTD PMID:30779732 Sparcl1 Rat aristolochic acid A increases expression ISO SPARCL1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SPARCL1 mRNA CTD PMID:33212167 Sparcl1 Rat arsane affects methylation ISO SPARCL1 (Homo sapiens) 6480464 Arsenic affects the methylation of SPARCL1 gene CTD PMID:25304211 Sparcl1 Rat arsenic atom affects methylation ISO SPARCL1 (Homo sapiens) 6480464 Arsenic affects the methylation of SPARCL1 gene CTD PMID:25304211 Sparcl1 Rat benzo[a]pyrene decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SPARCL1 mRNA CTD PMID:20106945 and PMID:32234424 Sparcl1 Rat benzo[a]pyrene increases methylation ISO SPARCL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SPARCL1 promoter CTD PMID:27901495 Sparcl1 Rat benzo[a]pyrene increases expression ISO Sparcl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SPARCL1 mRNA CTD PMID:22228805 Sparcl1 Rat benzo[a]pyrene decreases expression ISO Sparcl1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SPARCL1 mRNA CTD PMID:20713471 Sparcl1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sparcl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SPARCL1 mRNA CTD PMID:34319233 Sparcl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SPARCL1 mRNA CTD PMID:25181051 more ... Sparcl1 Rat bisphenol A increases expression ISO Sparcl1 (Mus musculus) 6480464 bisphenol A results in increased expression of SPARCL1 mRNA CTD PMID:30951980 and PMID:35479511 Sparcl1 Rat bisphenol A multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SPARCL1 mRNA CTD PMID:28628672 Sparcl1 Rat bisphenol F increases expression ISO Sparcl1 (Mus musculus) 6480464 bisphenol F results in increased expression of SPARCL1 mRNA CTD PMID:30951980 Sparcl1 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of SPARCL1 protein CTD PMID:25933445 Sparcl1 Rat cadmium atom multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SPARCL1 mRNA CTD PMID:37325564 Sparcl1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of SPARCL1 promoter CTD PMID:22457795 Sparcl1 Rat cadmium dichloride multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SPARCL1 mRNA CTD PMID:37325564 Sparcl1 Rat calcitriol increases expression ISO SPARCL1 (Homo sapiens) 6480464 Calcitriol results in increased expression of SPARCL1 mRNA CTD PMID:16002434 Sparcl1 Rat cantharidin decreases expression ISO Sparcl1 (Mus musculus) 6480464 Cantharidin results in decreased expression of SPARCL1 mRNA CTD PMID:36907384 Sparcl1 Rat carbon nanotube increases expression ISO Sparcl1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SPARCL1 mRNA CTD PMID:25620056 Sparcl1 Rat casticin increases expression ISO Sparcl1 (Mus musculus) 6480464 casticin results in increased expression of SPARCL1 mRNA CTD PMID:28444820 Sparcl1 Rat CGP 52608 multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SPARCL1 gene] CTD PMID:28238834 Sparcl1 Rat chitosan decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Chitosan results in decreased expression of SPARCL1 mRNA CTD PMID:36706893 Sparcl1 Rat choline multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SPARCL1 mRNA CTD PMID:20938992 Sparcl1 Rat chrysene increases expression ISO Sparcl1 (Mus musculus) 6480464 chrysene results in increased expression of SPARCL1 mRNA CTD PMID:26377693 Sparcl1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of SPARCL1 mRNA CTD PMID:20187946 Sparcl1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SPARCL1 mRNA CTD PMID:30556269 Sparcl1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SPARCL1 mRNA CTD PMID:30556269 Sparcl1 Rat cordycepin decreases expression ISO SPARCL1 (Homo sapiens) 6480464 cordycepin results in decreased expression of SPARCL1 mRNA CTD PMID:34858524 Sparcl1 Rat cyclosporin A decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SPARCL1 mRNA CTD PMID:20106945 Sparcl1 Rat dexamethasone multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SPARCL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SPARCL1 mRNA CTD PMID:28628672 Sparcl1 Rat dichloroacetic acid decreases expression ISO Sparcl1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of SPARCL1 mRNA CTD PMID:28962523 Sparcl1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of SPARCL1 mRNA CTD PMID:21551480 Sparcl1 Rat doxorubicin decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SPARCL1 mRNA CTD PMID:29803840 Sparcl1 Rat epoxiconazole decreases expression ISO Sparcl1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SPARCL1 mRNA CTD PMID:35436446 Sparcl1 Rat ethanol multiple interactions ISO Sparcl1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SPARCL1 mRNA CTD PMID:30319688 Sparcl1 Rat ethanol increases expression ISO Sparcl1 (Mus musculus) 6480464 Ethanol results in increased expression of SPARCL1 mRNA CTD PMID:30319688 Sparcl1 Rat ethyl methanesulfonate increases expression ISO SPARCL1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of SPARCL1 mRNA CTD PMID:23649840 Sparcl1 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of SPARCL1 mRNA CTD PMID:37156404 Sparcl1 Rat folic acid multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Sparcl1 Rat formaldehyde increases expression ISO SPARCL1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SPARCL1 mRNA CTD PMID:23649840 Sparcl1 Rat genistein decreases methylation EXP 6480464 Genistein results in decreased methylation of SPARCL1 gene CTD PMID:28505145 Sparcl1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of SPARCL1 mRNA CTD PMID:21396975 Sparcl1 Rat indometacin multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SPARCL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SPARCL1 mRNA CTD PMID:28628672 Sparcl1 Rat inulin multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SPARCL1 mRNA CTD PMID:36331819 Sparcl1 Rat L-ascorbic acid increases expression ISO Sparcl1 (Mus musculus) 6480464 Ascorbic Acid results in increased expression of SPARCL1 mRNA CTD PMID:15305145 Sparcl1 Rat L-methionine multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SPARCL1 mRNA CTD PMID:20938992 Sparcl1 Rat Lasiocarpine decreases expression ISO SPARCL1 (Homo sapiens) 6480464 lasiocarpine results in decreased expression of SPARCL1 mRNA CTD PMID:32234424 Sparcl1 Rat lead(0) affects expression ISO SPARCL1 (Homo sapiens) 6480464 Lead affects the expression of SPARCL1 mRNA CTD PMID:28903495 Sparcl1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of SPARCL1 mRNA CTD PMID:24136188 Sparcl1 Rat lithium atom affects localization EXP 6480464 Lithium affects the localization of SPARCL1 protein CTD PMID:18488994 Sparcl1 Rat lithium hydride affects localization EXP 6480464 Lithium affects the localization of SPARCL1 protein CTD PMID:18488994 Sparcl1 Rat methyl methanesulfonate increases expression ISO SPARCL1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SPARCL1 mRNA CTD PMID:23649840 Sparcl1 Rat methylmercury chloride increases expression ISO SPARCL1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SPARCL1 mRNA CTD PMID:23179753 Sparcl1 Rat miconazole increases expression ISO Sparcl1 (Mus musculus) 6480464 Miconazole results in increased expression of SPARCL1 mRNA CTD PMID:27462272 Sparcl1 Rat N-nitrosodiethylamine multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of SPARCL1 mRNA CTD PMID:24535843 Sparcl1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of SPARCL1 mRNA CTD PMID:33484710 Sparcl1 Rat O-methyleugenol decreases expression ISO SPARCL1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of SPARCL1 mRNA CTD PMID:32234424 Sparcl1 Rat perfluorononanoic acid affects expression ISO SPARCL1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid affects the expression of SPARCL1 protein CTD PMID:38537583 Sparcl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SPARCL1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SPARCL1 mRNA CTD PMID:36331819 Sparcl1 Rat phenobarbital multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of SPARCL1 mRNA CTD PMID:24535843 Sparcl1 Rat pioglitazone multiple interactions ISO Sparcl1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of SPARCL1 mRNA CTD PMID:27935865 Sparcl1 Rat pirinixic acid multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SPARCL1 mRNA CTD PMID:19710929 Sparcl1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of SPARCL1 mRNA CTD PMID:19162173 Sparcl1 Rat progesterone multiple interactions ISO SPARCL1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SPARCL1 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of SPARCL1 mRNA CTD PMID:17404688 and PMID:20660070 Sparcl1 Rat progesterone increases expression ISO SPARCL1 (Homo sapiens) 6480464 Progesterone results in increased expression of SPARCL1 mRNA CTD PMID:17404688 and PMID:20864642 Sparcl1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of SPARCL1 mRNA CTD PMID:28374803 Sparcl1 Rat sodium arsenate increases expression ISO Sparcl1 (Mus musculus) 6480464 sodium arsenate results in increased expression of SPARCL1 mRNA CTD PMID:21795629 Sparcl1 Rat sodium arsenite decreases expression ISO SPARCL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SPARCL1 mRNA CTD PMID:29301061 Sparcl1 Rat sodium arsenite increases expression ISO Sparcl1 (Mus musculus) 6480464 sodium arsenite results in increased expression of SPARCL1 mRNA CTD PMID:37682722 Sparcl1 Rat tetrachloromethane affects expression ISO Sparcl1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SPARCL1 mRNA CTD PMID:17484886 Sparcl1 Rat tetrachloromethane increases expression ISO Sparcl1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SPARCL1 mRNA CTD PMID:29987408 Sparcl1 Rat titanium dioxide affects expression ISO Sparcl1 (Mus musculus) 6480464 titanium dioxide affects the expression of SPARCL1 mRNA CTD PMID:17656681 Sparcl1 Rat trimellitic anhydride decreases expression ISO Sparcl1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of SPARCL1 mRNA CTD PMID:19042947 Sparcl1 Rat troglitazone decreases expression ISO Sparcl1 (Mus musculus) 6480464 troglitazone results in decreased expression of SPARCL1 mRNA CTD PMID:28973697 Sparcl1 Rat troglitazone decreases expression ISO SPARCL1 (Homo sapiens) 6480464 troglitazone results in decreased expression of SPARCL1 mRNA CTD PMID:25572481 Sparcl1 Rat undecane increases expression EXP 6480464 undecane results in increased expression of SPARCL1 protein CTD PMID:17337753 Sparcl1 Rat valproic acid increases expression ISO SPARCL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SPARCL1 mRNA CTD PMID:24383497 Sparcl1 Rat valproic acid affects expression ISO SPARCL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of SPARCL1 mRNA CTD PMID:25979313 Sparcl1 Rat valproic acid decreases expression ISO SPARCL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SPARCL1 mRNA CTD PMID:23179753 Sparcl1 Rat vancomycin decreases expression ISO Sparcl1 (Mus musculus) 6480464 Vancomycin results in decreased expression of SPARCL1 mRNA CTD PMID:18930951 Sparcl1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SPARCL1 mRNA CTD PMID:23869203
(+)-pilocarpine (EXP) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) cantharidin (ISO) carbon nanotube (ISO) casticin (ISO) CGP 52608 (ISO) chitosan (ISO) choline (ISO) chrysene (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) cordycepin (ISO) cyclosporin A (ISO) dexamethasone (ISO) dichloroacetic acid (ISO) diuron (EXP) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fentin chloride (EXP) folic acid (ISO) formaldehyde (ISO) genistein (EXP) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) L-ascorbic acid (ISO) L-methionine (ISO) Lasiocarpine (ISO) lead(0) (ISO) leflunomide (EXP) lithium atom (EXP) lithium hydride (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) miconazole (ISO) N-nitrosodiethylamine (ISO) nitrofen (EXP) O-methyleugenol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pioglitazone (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) rotenone (EXP) sodium arsenate (ISO) sodium arsenite (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) troglitazone (ISO) undecane (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Molecular cloning of SC1: a putative brain extracellular matrix glycoprotein showing partial similarity to osteonectin/BM40/SPARC.
Johnston IG, etal., Neuron 1990 Jan;4(1):165-76.
3.
Control of excitatory CNS synaptogenesis by astrocyte-secreted proteins Hevin and SPARC.
Kucukdereli H, etal., Proc Natl Acad Sci U S A. 2011 Aug 9;108(32):E440-9. doi: 10.1073/pnas.1104977108. Epub 2011 Jul 25.
4.
Localization of the extracellular matrix protein SC1 to synapses in the adult rat brain.
Lively S, etal., Neurochem Res. 2007 Jan;32(1):65-71. doi: 10.1007/s11064-006-9226-4. Epub 2006 Dec 7.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Sparcl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 5,937,484 - 5,968,532 (+) NCBI GRCr8 mRatBN7.2 14 5,632,816 - 5,663,866 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 5,632,569 - 5,663,865 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 5,601,783 - 5,632,794 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 6,902,017 - 6,933,024 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 5,600,631 - 5,631,801 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 6,994,261 - 7,025,309 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 6,994,190 - 7,025,308 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 6,985,394 - 7,016,296 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 6,766,347 - 6,797,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 6,766,346 - 6,797,580 (+) NCBI Celera 14 5,771,812 - 5,802,805 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
SPARCL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 87,473,335 - 87,529,376 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 87,473,335 - 87,531,061 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 88,394,487 - 88,450,528 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 88,613,511 - 88,669,530 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 88,751,668 - 88,807,685 NCBI Celera 4 85,683,694 - 85,739,861 (-) NCBI Celera Cytogenetic Map 4 q22.1 NCBI HuRef 4 84,140,423 - 84,196,598 (-) NCBI HuRef CHM1_1 4 88,371,316 - 88,427,455 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 90,802,350 - 90,858,405 (-) NCBI T2T-CHM13v2.0
Sparcl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 104,226,974 - 104,261,954 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 104,226,977 - 104,261,599 (-) Ensembl GRCm39 Ensembl GRCm38 5 104,079,108 - 104,114,088 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 104,079,111 - 104,113,733 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 104,508,127 - 104,543,107 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 104,319,413 - 104,354,006 (-) NCBI MGSCv36 mm8 Celera 5 101,385,822 - 101,420,665 (-) NCBI Celera Cytogenetic Map 5 E5 NCBI cM Map 5 50.55 NCBI
Sparcl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 2,370,237 - 2,391,285 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 2,352,662 - 2,387,237 (+) NCBI ChiLan1.0 ChiLan1.0
SPARCL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 85,482,960 - 85,539,823 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 85,745,304 - 85,802,172 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 79,769,085 - 79,825,430 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 90,495,769 - 90,551,960 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 90,498,810 - 90,521,665 (-) Ensembl panpan1.1 panPan2
HSD17B11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 10,821,332 - 10,854,541 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 10,794,617 - 10,854,193 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 31,099,926 - 31,132,979 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 10,873,296 - 10,906,759 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 10,845,726 - 10,906,673 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 10,954,508 - 10,987,556 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 10,782,541 - 10,815,990 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 29,139,474 - 29,172,518 (+) NCBI UU_Cfam_GSD_1.0
Sparcl1
SPARCL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 131,386,973 - 131,431,200 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 131,386,804 - 131,431,427 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 140,599,058 - 140,643,513 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SPARCL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 35,858,402 - 35,914,776 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 35,857,559 - 35,915,115 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 14,558,006 - 14,615,157 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sparcl1
.
Predicted Target Of
Count of predictions: 26 Count of miRNA genes: 25 Interacting mature miRNAs: 26 Transcripts: ENSRNOT00000020357 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 724541 Niddm53 Non-insulin dependent diabetes mellitus QTL 53 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 3813074 9088978 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 71115 Niddm15 Non-insulin dependent diabetes mellitus QTL 15 4.8 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 1217606 11030812 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat
D14Wox22
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 5,663,514 - 5,663,677 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,024,958 - 7,025,120 NCBI Rnor6.0 Rnor_5.0 14 7,015,945 - 7,016,107 UniSTS Rnor5.0 RGSC_v3.4 14 6,797,230 - 6,797,392 UniSTS RGSC3.4 Celera 14 5,802,454 - 5,802,616 UniSTS Cytogenetic Map 14 p22 UniSTS
AW529913
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 5,650,920 - 5,651,114 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,012,366 - 7,012,559 NCBI Rnor6.0 Rnor_5.0 14 7,003,353 - 7,003,546 UniSTS Rnor5.0 RGSC_v3.4 14 6,784,638 - 6,784,831 UniSTS RGSC3.4 Celera 14 5,789,860 - 5,790,053 UniSTS RH 3.4 Map 14 115.7 UniSTS Cytogenetic Map 14 p22 UniSTS
D21S1917
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 10,198,146 - 10,198,193 (+) MAPPER mRatBN7.2 mRatBN7.2 14 5,647,345 - 5,647,929 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,008,791 - 7,009,374 NCBI Rnor6.0 Rnor_6.0 19 10,615,050 - 10,615,096 NCBI Rnor6.0 Rnor_5.0 19 10,609,857 - 10,609,903 UniSTS Rnor5.0 Rnor_5.0 14 6,999,778 - 7,000,361 UniSTS Rnor5.0 RGSC_v3.4 14 6,781,063 - 6,781,646 UniSTS RGSC3.4 RGSC_v3.4 19 10,637,206 - 10,637,252 UniSTS RGSC3.4 Celera 19 10,084,530 - 10,084,576 UniSTS Celera 14 5,786,285 - 5,786,868 UniSTS Cytogenetic Map 14 p22 UniSTS
SPARCL1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 5,658,228 - 5,658,324 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,019,673 - 7,019,768 NCBI Rnor6.0 Rnor_5.0 14 7,010,660 - 7,010,755 UniSTS Rnor5.0 RGSC_v3.4 14 6,791,945 - 6,792,040 UniSTS RGSC3.4 Celera 14 5,797,169 - 5,797,264 UniSTS Cytogenetic Map 14 p22 UniSTS
RH133331
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 5,663,520 - 5,663,724 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,024,964 - 7,025,167 NCBI Rnor6.0 Rnor_5.0 14 7,015,951 - 7,016,154 UniSTS Rnor5.0 RGSC_v3.4 14 6,797,236 - 6,797,439 UniSTS RGSC3.4 Celera 14 5,802,460 - 5,802,663 UniSTS RH 3.4 Map 14 116.4 UniSTS Cytogenetic Map 14 p22 UniSTS
RH137752
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 5,948,174 - 5,948,353 (+) Marker Load Pipeline mRatBN7.2 14 5,643,506 - 5,643,685 (+) MAPPER mRatBN7.2 Rnor_6.0 14 7,004,952 - 7,005,130 NCBI Rnor6.0 Rnor_5.0 14 6,995,939 - 6,996,117 UniSTS Rnor5.0 RGSC_v3.4 14 6,777,224 - 6,777,402 UniSTS RGSC3.4 Celera 14 5,782,446 - 5,782,624 UniSTS RH 3.4 Map 14 88.2 UniSTS Cytogenetic Map 14 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020357 ⟹ ENSRNOP00000020357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 5,632,569 - 5,663,865 (+) Ensembl Rnor_6.0 Ensembl 14 6,994,190 - 7,025,308 (+) Ensembl
RefSeq Acc Id:
NM_012946 ⟹ NP_037078
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 5,937,484 - 5,968,532 (+) NCBI mRatBN7.2 14 5,632,816 - 5,663,866 (+) NCBI Rnor_6.0 14 6,994,261 - 7,025,309 (+) NCBI Rnor_5.0 14 6,985,394 - 7,016,296 (+) NCBI RGSC_v3.4 14 6,766,347 - 6,797,581 (+) RGD Celera 14 5,771,812 - 5,802,805 (+) RGD
Sequence:
TCTGCGCTGCCTGCGAACGTCTGCAGCACGGAGCCAGCGAGGGAGGGAGATCCAGGAATCCGCAGCAGAAACCATGACATCCTGCGACACCCTGTGGTGCCAACCTCCAAGCTCTCATCTGTCACTCT
hide sequence
RefSeq Acc Id:
NP_037078 ⟸ NM_012946
- Peptide Label:
precursor
- UniProtKB:
A6K5T4 (UniProtKB/TrEMBL), Q6P7A8 (UniProtKB/TrEMBL)
- Sequence:
MKAVLLLLYALGIAAAVPTTFLSDHSNPTSATLPTLEDATVPTVPAEAAADIEKHPNHKAEKPSALNSEEEAHEQSTEQDKTYSFEVDLKDEEDGDGDLSVDPTERTLDLQEGTSEPQQKRLPENADF
hide sequence
Ensembl Acc Id:
ENSRNOP00000020357 ⟸ ENSRNOT00000020357
RGD ID: 13699175 Promoter ID: EPDNEW_R9700 Type: initiation region Name: Sparcl1_1 Description: SPARC like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 6,994,235 - 6,994,295 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Sparcl1
SPARC like 1
Sparcl1
SPARC-like 1 (hevin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Sparcl1
SPARC-like 1 (hevin)
Sparcl1
SPARC-like 1 (mast9, hevin)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Sparcl1
SPARC-like 1 (mast9, hevin)
SPARC-like 1
Name updated
1299863 APPROVED
2002-11-06
Sparcl1
SPARC-like 1
Ecm2
Extracellular matrix protein 2
Symbol and Name updated
625702 APPROVED
2002-06-10
Ecm2
Extracellular matrix protein 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in brain and neurons during development and in adult
1298897
gene_homology
has high similarity to extracellular matrix glycoprotein osteonectin/BM40/SPARC
1298897
gene_physical_interaction
binds calcium
1298897
gene_product
secreted glycoprotein
1298897
