Symbol:
Ctf1
Name:
cardiotrophin 1
RGD ID:
2442
Description:
Enables cytokine activity and leukemia inhibitory factor receptor binding activity. Involved in leukemia inhibitory factor signaling pathway and nervous system development. Predicted to be located in extracellular space. Predicted to be active in extracellular region. Biomarker of hypertension and hypertrophic cardiomyopathy. Human ortholog(s) of this gene implicated in dilated cardiomyopathy. Orthologous to human CTF1 (cardiotrophin 1); PARTICIPATES IN cytokine mediated signaling pathway; Jak-Stat signaling pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; 1,2,4-trimethylbenzene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cardiotrophin-1; CT-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CTF1 (cardiotrophin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ctf1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ctf1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CTF1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CTF1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ctf1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CTF1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103231119 (cardiotrophin-1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ctf1 (cardiotrophin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ctf1 (cardiotrophin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CTF1 (cardiotrophin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ctf1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 191,758,512 - 191,771,259 (+) NCBI GRCr8 mRatBN7.2 1 182,328,035 - 182,336,346 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 182,328,090 - 182,333,335 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 190,678,674 - 190,683,883 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 197,864,766 - 197,869,976 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 190,535,271 - 190,540,479 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 199,162,319 - 199,168,296 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 199,163,086 - 199,168,296 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 206,186,511 - 206,191,930 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 187,001,445 - 187,006,655 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 187,151,325 - 187,156,536 (+) NCBI Celera 1 179,979,246 - 179,984,456 (+) NCBI Celera Cytogenetic Map 1 q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ctf1 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of CTF1 mRNA CTD PMID:10506506 Ctf1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CTF1 mRNA] CTD PMID:31150632 Ctf1 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of CTF1 protein CTD PMID:17337753 Ctf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CTF1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CTF1 mRNA CTD PMID:17101203 Ctf1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CTF1 mRNA CTD PMID:33387578 Ctf1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ctf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CTF1 mRNA CTD PMID:21570461 Ctf1 Rat 2-methoxy-17beta-estradiol multiple interactions ISO Ctf1 (Mus musculus) 6480464 2-Methoxyestradiol inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] and 2-Methoxyestradiol inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] CTD PMID:16507596 Ctf1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ctf1 (Mus musculus) 6480464 Fenretinide results in increased expression of CTF1 mRNA CTD PMID:28973697 Ctf1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CTF1 mRNA CTD PMID:24780913 Ctf1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CTF1 mRNA CTD PMID:30047161 Ctf1 Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin promotes the reaction [Spironolactone inhibits the reaction [AGT protein results in increased expression of CTF1 mRNA]] and Dactinomycin promotes the reaction [Valsartan inhibits the reaction [AGT protein results in increased expression of CTF1 mRNA]] CTD PMID:23288202 Ctf1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CTF1 mRNA CTD PMID:30047161 Ctf1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CTF1 mRNA CTD PMID:16483693 Ctf1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO Ctf1 (Mus musculus) 6480464 pyrazolanthrone inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] and pyrazolanthrone inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] CTD PMID:16507596 Ctf1 Rat apocynin multiple interactions ISO Ctf1 (Mus musculus) 6480464 acetovanillone inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] and acetovanillone inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] CTD PMID:16507596 Ctf1 Rat arsane affects methylation ISO CTF1 (Homo sapiens) 6480464 Arsenic affects the methylation of CTF1 gene CTD PMID:25304211 Ctf1 Rat arsenic atom affects methylation ISO CTF1 (Homo sapiens) 6480464 Arsenic affects the methylation of CTF1 gene CTD PMID:25304211 Ctf1 Rat arsenous acid multiple interactions ISO CTF1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CTF1 protein] CTD PMID:26598702 Ctf1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of CTF1 mRNA CTD PMID:36841081 Ctf1 Rat benzo[a]pyrene affects methylation ISO CTF1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CTF1 promoter CTD PMID:27901495 Ctf1 Rat benzo[e]pyrene decreases methylation ISO CTF1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of CTF1 intron CTD PMID:30157460 Ctf1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CTF1 mRNA CTD PMID:25181051 Ctf1 Rat bisphenol A increases expression ISO Ctf1 (Mus musculus) 6480464 bisphenol A results in increased expression of CTF1 mRNA CTD PMID:32156529 Ctf1 Rat butanal decreases expression ISO CTF1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CTF1 mRNA CTD PMID:26079696 Ctf1 Rat cadmium atom increases expression ISO CTF1 (Homo sapiens) 6480464 Cadmium results in increased expression of CTF1 mRNA CTD PMID:21694771 Ctf1 Rat carmustine decreases expression ISO CTF1 (Homo sapiens) 6480464 Carmustine results in decreased expression of CTF1 mRNA CTD PMID:15980968 Ctf1 Rat CGP 52608 multiple interactions ISO CTF1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CTF1 gene] CTD PMID:28238834 Ctf1 Rat cis-caffeic acid multiple interactions ISO CTF1 (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in decreased expression of CTF1 mRNA] CTD PMID:19442820 Ctf1 Rat cobalt dichloride multiple interactions ISO Ctf1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] more ... CTD PMID:16507596 Ctf1 Rat cobalt dichloride increases expression ISO Ctf1 (Mus musculus) 6480464 cobaltous chloride results in increased expression of CTF1 mRNA and cobaltous chloride results in increased expression of CTF1 protein CTD PMID:16507596 Ctf1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of CTF1 mRNA CTD PMID:18480146 Ctf1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CTF1 mRNA CTD PMID:26577399 Ctf1 Rat DDE decreases expression ISO CTF1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CTF1 mRNA CTD PMID:38568856 Ctf1 Rat diarsenic trioxide multiple interactions ISO CTF1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CTF1 protein] CTD PMID:26598702 Ctf1 Rat dibenziodolium multiple interactions ISO Ctf1 (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] and diphenyleneiodonium inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] CTD PMID:16507596 Ctf1 Rat dioxygen increases expression ISO Ctf1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of CTF1 protein CTD PMID:16507596 Ctf1 Rat dobutamine affects response to substance ISO Ctf1 (Mus musculus) 6480464 CTF1 protein affects the susceptibility to Dobutamine CTD PMID:17150369 Ctf1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CTF1 mRNA CTD PMID:24136188 Ctf1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CTF1 mRNA CTD PMID:24793618 Ctf1 Rat gentamycin multiple interactions EXP 6480464 CTF1 protein inhibits the reaction [[Diatrizoate Meglumine co-treated with Gentamicins] results in increased cleavage of CASP3 protein] more ... CTD PMID:23335628 Ctf1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CTF1 mRNA CTD PMID:22061828 and PMID:33387578 Ctf1 Rat hydrogen peroxide increases expression ISO Ctf1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of CTF1 mRNA and Hydrogen Peroxide results in increased expression of CTF1 protein CTD PMID:16507596 Ctf1 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of CTF1 mRNA and Isoproterenol results in increased expression of CTF1 protein CTD PMID:23288202 Ctf1 Rat isoprenaline multiple interactions EXP 6480464 Spironolactone inhibits the reaction [Isoproterenol results in increased expression of CTF1 mRNA] more ... CTD PMID:23288202 Ctf1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of CTF1 mRNA CTD PMID:24136188 Ctf1 Rat LY294002 multiple interactions ISO Ctf1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased expression of CTF1 protein] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] CTD PMID:16507596 Ctf1 Rat mancozeb decreases expression ISO CTF1 (Homo sapiens) 6480464 mancozeb results in decreased expression of CTF1 mRNA CTD PMID:33396126 Ctf1 Rat meglumine amidotrizoate multiple interactions EXP 6480464 CTF1 protein inhibits the reaction [[Diatrizoate Meglumine co-treated with Gentamicins] results in increased cleavage of CASP3 protein] more ... CTD PMID:23335628 Ctf1 Rat menadione multiple interactions ISO Ctf1 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Vitamin K 3 results in increased expression of CTF1 protein] more ... CTD PMID:16507596 Ctf1 Rat menadione increases expression ISO Ctf1 (Mus musculus) 6480464 Vitamin K 3 results in increased expression of CTF1 mRNA and Vitamin K 3 results in increased expression of CTF1 protein CTD PMID:16507596 Ctf1 Rat methapyrilene decreases methylation ISO CTF1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of CTF1 intron CTD PMID:30157460 Ctf1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CTF1 mRNA CTD PMID:30047161 Ctf1 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of CTF1 gene CTD PMID:23303685 Ctf1 Rat mevalonic acid multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [CTF1 results in increased expression of JAK1 protein]] more ... CTD PMID:16534557 Ctf1 Rat nitric oxide increases chemical synthesis EXP 6480464 CTF1 protein results in increased chemical synthesis of Nitric Oxide CTD PMID:11304496 Ctf1 Rat paracetamol affects expression ISO Ctf1 (Mus musculus) 6480464 Acetaminophen affects the expression of CTF1 mRNA CTD PMID:17562736 Ctf1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CTF1 mRNA CTD PMID:33387578 Ctf1 Rat paracetamol decreases expression ISO CTF1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CTF1 mRNA CTD PMID:26690555 Ctf1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of CTF1 mRNA CTD PMID:32680482 Ctf1 Rat pirinixic acid increases expression ISO Ctf1 (Mus musculus) 6480464 pirinixic acid results in increased expression of CTF1 mRNA CTD PMID:18301758 and PMID:23811191 Ctf1 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [sunitinib results in increased expression of CTF1 mRNA] CTD PMID:24247421 Ctf1 Rat resveratrol multiple interactions EXP 401793741 resveratrol inhibits the reaction [sunitinib increases expression of mRNA in rat cardiomyocytes] RGD Ctf1 Rat simvastatin multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [CTF1 results in increased expression of JAK1 protein]] more ... CTD PMID:16534557 more ... Ctf1 Rat sodium arsenite affects methylation ISO CTF1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of CTF1 gene CTD PMID:28589171 Ctf1 Rat sodium arsenite decreases expression ISO CTF1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CTF1 mRNA CTD PMID:34032870 and PMID:38568856 Ctf1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of CTF1 mRNA CTD PMID:19281266 Ctf1 Rat spironolactone multiple interactions EXP 6480464 Dactinomycin promotes the reaction [Spironolactone inhibits the reaction [AGT protein results in increased expression of CTF1 mRNA]] more ... CTD PMID:23288202 Ctf1 Rat sunitinib multiple interactions EXP 6480464 resveratrol inhibits the reaction [sunitinib results in increased expression of CTF1 mRNA] CTD PMID:24247421 Ctf1 Rat sunitinib increases expression EXP 401793741 sunitinib increases expression of mRNA in rat heart RGD Ctf1 Rat sunitinib increases expression EXP 6480464 sunitinib results in increased expression of CTF1 mRNA CTD PMID:24247421 Ctf1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CTF1 mRNA CTD PMID:31150632 Ctf1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CTF1 mRNA] CTD PMID:31150632 Ctf1 Rat thapsigargin multiple interactions ISO CTF1 (Homo sapiens) 6480464 [Thapsigargin co-treated with 4-methoxycinnamate methyl ester] results in decreased expression of CTF1 mRNA more ... CTD PMID:19442820 Ctf1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CTF1 mRNA CTD PMID:34492290 Ctf1 Rat titanium dioxide decreases expression ISO Ctf1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CTF1 mRNA CTD PMID:23131501 Ctf1 Rat trans-caffeic acid multiple interactions ISO CTF1 (Homo sapiens) 6480464 caffeic acid promotes the reaction [Thapsigargin results in decreased expression of CTF1 mRNA] CTD PMID:19442820 Ctf1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of CTF1 mRNA CTD PMID:30589522 Ctf1 Rat Triptolide decreases expression ISO Ctf1 (Mus musculus) 6480464 triptolide results in decreased expression of CTF1 mRNA CTD PMID:32835833 Ctf1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of CTF1 mRNA CTD PMID:24136188 Ctf1 Rat valproic acid increases methylation ISO CTF1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CTF1 gene CTD PMID:29154799 Ctf1 Rat valsartan multiple interactions EXP 6480464 Dactinomycin promotes the reaction [Valsartan inhibits the reaction [AGT protein results in increased expression of CTF1 mRNA]] more ... CTD PMID:23288202 Ctf1 Rat vitamin E decreases expression ISO Ctf1 (Mus musculus) 6480464 Vitamin E results in decreased expression of CTF1 protein CTD PMID:16507596
Imported Annotations - KEGG (archival)
1.
The cytoprotective effects of the glycoprotein 130 receptor-coupled cytokine, cardiotrophin-1, require activation of NF-kappa B.
Craig R, etal., J Biol Chem 2001 Oct 5;276(40):37621-9.
2.
Genetic variants in the promoter (g983G>T) and coding region (A92T) of the human cardiotrophin-1 gene (CTF1) in patients with dilated cardiomyopathy.
Erdmann J, etal., Hum Mutat. 2000 Nov;16(5):448.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
cDNA cloning of rat cardiotrophin-1 (CT-1): augmented expression of CT-1 gene in ventricle of genetically hypertensive rats.
Ishikawa M, etal., Biochem Biophys Res Commun 1996 Feb 15;219(2):377-81.
5.
Is plasma cardiotrophin-1 a marker of hypertensive heart disease?
Lopez B, etal., J Hypertens. 2005 Mar;23(3):625-32.
6.
Development of cardiac hypertrophy by sunitinib in vivo and in vitro rat cardiomyocytes is influenced by the aryl hydrocarbon receptor signaling pathway.
Maayah ZH, etal., Arch Toxicol. 2014 Mar;88(3):725-38. doi: 10.1007/s00204-013-1159-5. Epub 2013 Nov 19.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Comparison of the effects of HGF, BDNF, CT-1, CNTF, and the branchial arches on the growth of embryonic cranial motor neurons.
Naeem A, etal., J Neurobiol 2002 May;51(2):101-14.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
Cardiotrophin-1 and urocortin cause protection by the same pathway and hypertrophy via distinct pathways in cardiac myocytes.
Railson JE, etal., Cytokine 2002 Mar 7;17(5):243-53.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
Hypertrophic responses to cardiotrophin-1 are not mediated by STAT3, but via a MEK5-ERK5 pathway in cultured cardiomyocytes.
Takahashi N, etal., J Mol Cell Cardiol. 2005 Jan;38(1):185-92. Epub 2004 Dec 10.
17.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Ctf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 191,758,512 - 191,771,259 (+) NCBI GRCr8 mRatBN7.2 1 182,328,035 - 182,336,346 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 182,328,090 - 182,333,335 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 190,678,674 - 190,683,883 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 197,864,766 - 197,869,976 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 190,535,271 - 190,540,479 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 199,162,319 - 199,168,296 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 199,163,086 - 199,168,296 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 206,186,511 - 206,191,930 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 187,001,445 - 187,006,655 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 187,151,325 - 187,156,536 (+) NCBI Celera 1 179,979,246 - 179,984,456 (+) NCBI Celera Cytogenetic Map 1 q37 NCBI
CTF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 30,895,846 - 30,903,560 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 30,896,614 - 30,903,547 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 30,907,935 - 30,914,881 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 30,815,429 - 30,822,382 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 30,815,428 - 30,822,381 NCBI Celera 16 29,382,737 - 29,389,814 (-) NCBI Celera Cytogenetic Map 16 p11.2 NCBI HuRef 16 28,470,690 - 28,477,682 (+) NCBI HuRef CHM1_1 16 32,225,018 - 32,231,972 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 31,283,287 - 31,291,024 (+) NCBI T2T-CHM13v2.0
Ctf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 127,311,872 - 127,317,360 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 127,311,908 - 127,317,364 (+) Ensembl GRCm39 Ensembl GRCm38 7 127,712,676 - 127,718,188 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 127,712,736 - 127,718,192 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 134,856,250 - 134,861,699 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 127,503,884 - 127,509,333 (+) NCBI MGSCv36 mm8 Celera 7 127,551,798 - 127,557,251 (+) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.69 NCBI
Ctf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955493 7,735,996 - 7,737,559 (+) NCBI ChiLan1.0 ChiLan1.0
CTF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 34,101,941 - 34,109,044 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 38,903,404 - 38,910,508 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 24,065,866 - 24,072,973 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 31,263,009 - 31,269,439 (+) NCBI panpan1.1 PanPan1.1 panPan2
CTF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 17,299,561 - 17,303,095 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 17,299,561 - 17,303,095 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 18,874,611 - 18,878,145 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 17,427,691 - 17,433,408 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 17,406,389 - 17,433,403 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 17,230,218 - 17,233,760 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 17,149,372 - 17,152,903 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 17,461,913 - 17,465,457 (-) NCBI UU_Cfam_GSD_1.0
Ctf1
CTF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 17,539,941 - 17,544,396 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 17,539,927 - 17,545,250 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 17,955,024 - 17,960,632 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103231119 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 27,579,175 - 27,586,779 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 27,579,987 - 27,585,759 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 1,878,594 - 1,886,866 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ctf1
.
Predicted Target Of
Count of predictions: 105 Count of miRNA genes: 83 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000025646 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 61378 Bp43 Blood pressure QTL 43 22.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 181746937 196383668 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
RH133519
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 182,332,974 - 182,333,193 (+) MAPPER mRatBN7.2 Rnor_6.0 1 199,167,936 - 199,168,154 NCBI Rnor6.0 Rnor_5.0 1 206,191,567 - 206,191,785 UniSTS Rnor5.0 RGSC_v3.4 1 187,006,295 - 187,006,513 UniSTS RGSC3.4 Celera 1 179,984,096 - 179,984,314 UniSTS Cytogenetic Map 1 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025646 ⟹ ENSRNOP00000025646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 182,328,784 - 182,333,335 (+) Ensembl Rnor_6.0 Ensembl 1 199,163,086 - 199,168,296 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103205 ⟹ ENSRNOP00000089496
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 182,328,090 - 182,333,335 (+) Ensembl
RefSeq Acc Id:
NM_017129 ⟹ NP_058825
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,602 - 191,763,812 (+) NCBI mRatBN7.2 1 182,328,125 - 182,333,335 (+) NCBI Rnor_6.0 1 199,163,086 - 199,168,296 (+) NCBI Rnor_5.0 1 206,186,511 - 206,191,930 (+) NCBI RGSC_v3.4 1 187,001,445 - 187,006,655 (+) RGD Celera 1 179,979,246 - 179,984,456 (+) RGD
Sequence:
GGTGTGTTGAAGGAAACAGGATCAGCCTGGGGCCAGCATGAGCCAGAGGGAGGGAAGTCTGGAAGACCACCAGACTGACTCCTCATTCTCATTCCTACCCCATTTGGAGGCCAAGATCCGACAGACAC
hide sequence
RefSeq Acc Id:
XM_006230221 ⟹ XP_006230283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,580 - 191,763,815 (+) NCBI mRatBN7.2 1 182,328,106 - 182,333,338 (+) NCBI Rnor_6.0 1 199,162,319 - 199,168,296 (+) NCBI Rnor_5.0 1 206,186,511 - 206,191,930 (+) NCBI
Sequence:
AAAAAAAAGTAGGTTGCAAAAGGTGTGCCTACACTCCATTATCTGAAACCTGAAACCAATGTGGATCCTCTGTGCCAGTGCCCAAGGCGCTTGGGAACCAATAGTAGAGGCAAGTGTGTCCAGTCCTT
hide sequence
RefSeq Acc Id:
XM_039103132 ⟹ XP_038959060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,512 - 191,771,259 (+) NCBI mRatBN7.2 1 182,328,035 - 182,336,332 (+) NCBI
RefSeq Acc Id:
XM_039103137 ⟹ XP_038959065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,512 - 191,771,259 (+) NCBI mRatBN7.2 1 182,328,035 - 182,336,346 (+) NCBI
RefSeq Acc Id:
XM_063282760 ⟹ XP_063138830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,573 - 191,771,259 (+) NCBI
RefSeq Acc Id:
XM_063282761 ⟹ XP_063138831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,750 - 191,771,259 (+) NCBI
RefSeq Acc Id:
XM_063282762 ⟹ XP_063138832
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,785 - 191,771,259 (+) NCBI
RefSeq Acc Id:
XM_063282763 ⟹ XP_063138833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,752 - 191,763,815 (+) NCBI
RefSeq Acc Id:
XM_063282764 ⟹ XP_063138834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 191,758,512 - 191,769,976 (+) NCBI
RefSeq Acc Id:
NP_058825 ⟸ NM_017129
- UniProtKB:
Q63086 (UniProtKB/Swiss-Prot), A6I9T6 (UniProtKB/TrEMBL), A0A8L2UK35 (UniProtKB/TrEMBL)
- Sequence:
MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQ
hide sequence
RefSeq Acc Id:
XP_006230283 ⟸ XM_006230221
- Peptide Label:
isoform X6
- UniProtKB:
A0A8L2UK35 (UniProtKB/TrEMBL)
- Sequence:
MSQREGSLDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQV
hide sequence
Ensembl Acc Id:
ENSRNOP00000025646 ⟸ ENSRNOT00000025646
RefSeq Acc Id:
XP_038959065 ⟸ XM_039103137
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038959060 ⟸ XM_039103132
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000089496 ⟸ ENSRNOT00000103205
RefSeq Acc Id:
XP_063138834 ⟸ XM_063282764
- Peptide Label:
isoform X8
- UniProtKB:
A0A8L2UK35 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138830 ⟸ XM_063282760
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063138831 ⟸ XM_063282761
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063138833 ⟸ XM_063282763
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6ABW6 (UniProtKB/TrEMBL), A6I9T7 (UniProtKB/TrEMBL), A0A8L2UK35 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138832 ⟸ XM_063282762
- Peptide Label:
isoform X5
RGD ID: 13690439 Promoter ID: EPDNEW_R964 Type: initiation region Name: Ctf1_1 Description: cardiotrophin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 199,163,109 - 199,163,169 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Ctf1
cardiotrophin 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_pathway
acts via the signal transducer and activator of transcription 3 (STAT3) pathway
727670
gene_process
promotes the outgrowth of embryonic cranial motor neurons
727568
gene_product
member of the interleukin-6 family of cytokines
727670
