Advanced Search (OLGA)

Gene: Amy1 (amylase alpha 1) Rattus norvegicus

Analyze

Symbol:

Amy1

Name:

amylase alpha 1

RGD ID:

2113

Description:

Predicted to enable alpha-amylase activity. Predicted to be involved in carbohydrate metabolic process. Located in extracellular space. Orthologous to several human genes including AMY2B (amylase alpha 2B); PARTICIPATES IN starch and sucrose metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-amylase; alpha-amylase 1; Amy1a; amylase 1; amylase 1, salivary; amylase, alpha 1A; amylase, alpha 1A (salivary)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AMY2B (amylase alpha 2B)	HGNC	Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Amy2a5 (amylase 2a5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100983088 (alpha-amylase 2B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC119881526 (pancreatic alpha-amylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AMY2A (amylase alpha 2A)	HGNC	HomoloGene, OrthoDB, Panther
Homo sapiens (human):	AMY1B (amylase alpha 1B)	HGNC	OrthoDB, Panther
Homo sapiens (human):	AMY1C (amylase alpha 1C)	HGNC	Panther
Homo sapiens (human):	AMY1A (amylase alpha 1A)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	AMY2A (amylase alpha 2A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AMY2B (amylase alpha 2B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amy1 (amylase 1, salivary)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:66313	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	amy2a (amylase alpha 2A (pancreatic))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:92137	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-d	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-p	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C50B6.7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amyrel	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	amy2b	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	amy2a	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	204,071,101 - 204,085,910 (-)	NCBI		GRCr8
mRatBN7.2	2	201,382,678 - 201,397,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	201,382,675 - 201,397,816 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	208,978,505 - 208,993,306 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	206,874,307 - 206,889,107 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	201,691,324 - 201,706,124 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	216,428,709 - 216,443,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	216,428,709 - 216,443,518 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	234,523,265 - 234,538,074 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	209,548,721 - 209,563,532 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	209,432,027 - 209,481,209 (-)	NCBI
Celera	2	193,917,226 - 193,932,026 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

epilepsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

4,4'-diaminodiphenylmethane (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

ammonium chloride (EXP)

apomorphine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atenolol (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

cisplatin (EXP,ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

endosulfan (EXP)

glafenine (EXP)

granisetron (EXP)

irinotecan (EXP)

isoprenaline (EXP)

lead diacetate (ISO)

lithium chloride (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

metoclopramide (EXP)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propranolol (EXP)

resveratrol (ISO)

SCH-351591 (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

tauroursodeoxycholic acid (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IBA)

response to bacterium (IEA)

Cellular Component

extracellular space (IBA,IDA,ISO)

Molecular Function

alpha-amylase activity (IBA,TAS)

amylase activity (ISO)

metal ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

starch and sucrose metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
4.	Structure of a family of rat amylase genes.	MacDonald RJ, etal., Nature 1980 Sep 11;287(5778):117-22.
5.	Proteomics analysis of pleomorphic adenoma of the human parotid gland.	Mutlu A, etal., Eur Arch Otorhinolaryngol. 2017 Aug;274(8):3183-3195. doi: 10.1007/s00405-017-4608-6. Epub 2017 May 11.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Alteration of alpha-amylase secretion from rat parotid cells in the absence of extracellular bicarbonate.	Youssef R, etal., Int J Mol Med 2003 Aug;12(2):199-200.

Additional References at PubMed

PMID:3025629	PMID:6163812	PMID:12477932	PMID:17537806	PMID:19408014	PMID:21832089	PMID:22768227	PMID:23012479	PMID:23533145	PMID:25804000

Genomics

Comparative Map Data

Amy1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	204,071,101 - 204,085,910 (-)	NCBI		GRCr8
mRatBN7.2	2	201,382,678 - 201,397,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	201,382,675 - 201,397,816 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	208,978,505 - 208,993,306 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	206,874,307 - 206,889,107 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	201,691,324 - 201,706,124 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	216,428,709 - 216,443,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	216,428,709 - 216,443,518 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	234,523,265 - 234,538,074 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	209,548,721 - 209,563,532 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	209,432,027 - 209,481,209 (-)	NCBI
Celera	2	193,917,226 - 193,932,026 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

AMY2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	103,554,644 - 103,579,534 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	103,553,815 - 103,579,534 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	104,097,266 - 104,122,156 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	103,898,845 - 103,923,674 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	103,809,342 - 103,834,168	NCBI
Celera	1	102,289,703 - 102,314,336 (+)	NCBI		Celera
Cytogenetic Map	1	p21.1	NCBI
HuRef	1	102,152,500 - 102,177,389 (+)	NCBI		HuRef
CHM1_1	1	104,212,451 - 104,237,341 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	103,403,587 - 103,428,477 (+)	NCBI		T2T-CHM13v2.0

Amy2a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	113,156,494 - 113,166,015 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	113,154,494 - 113,166,153 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	113,249,178 - 113,258,699 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	113,247,178 - 113,258,837 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	113,377,233 - 113,386,755 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	113,052,096 - 113,061,617 (-)	NCBI		MGSCv36	mm8
Celera	3	119,916,370 - 119,925,418 (-)	NCBI		Celera
Cytogenetic Map	3	F3	NCBI
cM Map	3	49.35	NCBI

LOC100983088
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	123,441,941 - 123,466,686 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	122,599,154 - 122,623,886 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	106,218,300 - 106,243,774 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	105,352,757 - 105,377,845 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	105,352,757 - 105,377,845 (+)	Ensembl	panpan1.1		panPan2

LOC119881526
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ROS_Cfam_1.0	6	47,266,205 - 47,273,361 (-)	NCBI		ROS_Cfam_1.0

Variants

Variants in Amy1
104 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	10
Count of miRNA genes:	10
Interacting mature miRNAs:	10
Transcripts:	ENSRNOT00000022496
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	11	29	101	90	88	59	23	59	6	172	75	81	23	46	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001010970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB057450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219213	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022496 ⟹ ENSRNOP00000022496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	216,428,709 - 216,443,518 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094692 ⟹ ENSRNOP00000080961

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	201,382,675 - 201,397,299 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097214 ⟹ ENSRNOP00000084129

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	201,382,675 - 201,392,800 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098690 ⟹ ENSRNOP00000088062

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	201,382,675 - 201,397,816 (-)	Ensembl

RefSeq Acc Id:

NM_001010970 ⟹ NP_001010970

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	204,071,101 - 204,085,910 (-)	NCBI
mRatBN7.2	2	201,382,678 - 201,397,487 (-)	NCBI
Rnor_6.0	2	216,428,709 - 216,443,518 (-)	NCBI
Rnor_5.0	2	234,523,265 - 234,538,074 (-)	NCBI
RGSC_v3.4	2	209,548,721 - 209,563,532 (-)	RGD
Celera	2	193,917,226 - 193,932,026 (-)	RGD

Sequence:

show sequence

AAAAGCTATACTCTAGATTTGGATGGTTGCTGGTTGATACAAGTTGATGAGAGAATACTGCCAA
CATCATAGCAGAATGAAATTCTTCCTGCTGCTTTCCCTCATTGGGCTCTGCTGGGCCCAATATG
ACCCACATACTTTTTATGGACGGTCTTCTATTGTCCATTTGTTCGAGTGGCGCTGGGTTGATAT
TGCTAAGGAGTGTGAGCGATATTTAGCTCCTAATGGATTTGGAGGCGTGCAGGTTTCTCCACCC
AATGAAAATATTGTGGTCAACAGTCCTTTTAGACCATGGTGGGAAAGATATCAACCAATTAGCT
ACAAAATATGCTCCAGGTCTGGAAATGAGGATGAATTCAGAGACATGGTGAACAGATGCAACAA
CGTTGGTGTCCGTATTTATGTGGATGCGGTCATTAATCACATGTGTGGGGTTGGGGCTGAAGCT
GGACAAAGCAGTACATGCGGAAGTTATTTCAACCCAAATAACAGGGACTTTCCTGGAGTTCCGT
ATTCTGGTTTCGACTTTAATGATGGGAAATGTAAAACTGGAAGTGGAGGCATTGAGAACTACAA
TGATGCTGCTCAGGTCAGAGATTGTCGTCTGTCTGGCCTTCTGGATCTTGCACTTGAGAAAGAT
TATGTTCGTACCAAGGTGGCTGATTACATGAACCATCTCATTGATATTGGTGTAGCAGGGTTCA
GACTTGATGCTTCTAAACACATGTGGCCTGGAGACATAAAGGCAGTTTTGGACAAACTACATAA
TCTAAATACAAAATGGTTCTCCGAAGGAAGCAAACCTTTCATTTATCAAGAGGTCATTGATCTG
GGTGGTGAAGCAGTGTCAAGTAATGAGTATTTTGGAAATGGCCGTGTGACAGAATTCAAATATG
GAGCAAAACTGGGCAAAGTTTTGCGCAAGTGGGATGGAGAAAAGATGGCCTACTTAAAGAACTG
GGGAGAAGGTTGGGGTTTCATGCCTTCTGACAGAGCCCTTGTCTTTGTGGACAACCATGACAAC
CAGCGAGGACATGGTGCTGGAGGATCATCCATCCTGACTTTCTGGGATGCTCGACTCTATAAAA
TGGCTGTCGGATTTATGTTGGCTCATCCTTATGGTTTCACTCGGGTAATGTCAAGTTTCCATTG
GCCAAGATATTTCGAGAATGGCAAAGATGTCAATGACTGGGTTGGACCACCTAATAACAATGGA
GCAACCAAAGAAGTGACCATTAACTCAGACAGCACTTGTGGCAATGACTGGGTCTGTGAACATC
GATGGCGTCAAATAAGGAACATGGTTGCCTTCAGGAATGTGGTCAATGGTCAGCCTTTTGCAAA
CTGGTGGGATAATGGCAGCAACCAAGTAGCTTTTGGCAGAGGAAACAAAGGCTTCATTGTCTTT
AACAATGATGACTGGGACTTGTCAACAACTCTACAGACTGGTCTTCCTGCTGGCACATACTGTG
ATGTCATTTCTGGAGACAAAGTCGATGGCAATTGCACTGGAATAAAAGTCTATGTTGGCAGTGA
TGGCAATGCTTACTTCTCTATTAGTAACTCTGCTGAAGACCCATTCATTGCAATCCATGTAGAG
TCAAAAATCTAAAATTTAAAATAAACATAAATTGAGAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001010970	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88228	(Get FASTA)	NCBI Sequence Viewer
	BAB39466	(Get FASTA)	NCBI Sequence Viewer
	EDL81998	(Get FASTA)	NCBI Sequence Viewer
	EDL81999	(Get FASTA)	NCBI Sequence Viewer
	EDL82000	(Get FASTA)	NCBI Sequence Viewer
	EDL82001	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080961.1
	ENSRNOP00000084129.1
	ENSRNOP00000088062.1

RefSeq Acc Id:	NP_001010970 ⟸ NM_001010970
- Peptide Label:	precursor
- UniProtKB:	Q99N59 (UniProtKB/TrEMBL), A6HV62 (UniProtKB/TrEMBL), A6HV63 (UniProtKB/TrEMBL), A0A8I6A5R3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MREYCQHHSRMKFFLLLSLIGLCWAQYDPHTFYGRSSIVHLFEWRWVDIAKECERYLAPNGFGG VQVSPPNENIVVNSPFRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMC GVGAEAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCKTGSGGIENYNDAAQVRDCRLSGLLD LALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAVLDKLHNLNTKWFSEGSKPFIY QEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVLRKWDGEKMAYLKNWGEGWGFMPSDRALVF VDNHDNQRGHGAGGSSILTFWDARLYKMAVGFMLAHPYGFTRVMSSFHWPRYFENGKDVNDWVG PPNNNGATKEVTINSDSTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFGRGN KGFIVFNNDDWDLSTTLQTGLPAGTYCDVISGDKVDGNCTGIKVYVGSDGNAYFSISNSAEDPF IAIHVESKI hide sequence

Ensembl Acc Id:

ENSRNOP00000022496 ⟸ ENSRNOT00000022496

Ensembl Acc Id:

ENSRNOP00000088062 ⟸ ENSRNOT00000098690

Ensembl Acc Id:

ENSRNOP00000084129 ⟸ ENSRNOT00000097214

Ensembl Acc Id:

ENSRNOP00000080961 ⟸ ENSRNOT00000094692

Protein Domains

Alpha-amylase C-terminal Glycosyl hydrolase family 13 catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PSQ1-F1-model_v2	AlphaFold	E9PSQ1	1-521	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2113	AgrOrtholog
BioCyc Gene	G2FUF-51535	BioCyc
Ensembl Genes	ENSRNOG00000033529	Ensembl
	ENSRNOG00000064517	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000094692.1	UniProtKB/TrEMBL
	ENSRNOT00000097214.1	UniProtKB/TrEMBL
	ENSRNOT00000098690.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.1180	UniProtKB/TrEMBL
	Glycosidases	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7323054	IMAGE-MGC_LOAD
InterPro	A-amylase_b_C	UniProtKB/TrEMBL
	A-amylase_C	UniProtKB/TrEMBL
	Glyco_hydro_13	UniProtKB/TrEMBL
	Glyco_hydro_13_cat_dom	UniProtKB/TrEMBL
	Glyco_hydro_b	UniProtKB/TrEMBL
	Glycoside_hydrolase_SF	UniProtKB/TrEMBL
KEGG Report	rno:24203	UniProtKB/TrEMBL
MGC_CLONE	MGC:108989	IMAGE-MGC_LOAD
NCBI Gene	24203	ENTREZGENE
PANTHER	ALPHA-AMYLASE	UniProtKB/TrEMBL
	ALPHA-AMYLASE 1	UniProtKB/TrEMBL
Pfam	Alpha-amylase	UniProtKB/TrEMBL
	Alpha-amylase_C	UniProtKB/TrEMBL
PhenoGen	Amy1	PhenoGen
PRINTS	ALPHAAMYLASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000033529	RatGTEx
	ENSRNOG00000064517	RatGTEx
SMART	Aamy	UniProtKB/TrEMBL
	Aamy_C	UniProtKB/TrEMBL
Superfamily-SCOP	Glyco_hydro_cat	UniProtKB/TrEMBL
	Glycosyl hydrolase domain	UniProtKB/TrEMBL
UniProt	A0A8I5ZU41_RAT	UniProtKB/TrEMBL
	A0A8I5ZY75_RAT	UniProtKB/TrEMBL
	A0A8I6A5R3	ENTREZGENE, UniProtKB/TrEMBL
	A6HV62	ENTREZGENE, UniProtKB/TrEMBL
	A6HV63	ENTREZGENE, UniProtKB/TrEMBL
	Q99N59	ENTREZGENE
UniProt Secondary	Q99N59	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-12-16	Amy1	amylase alpha 1	Amy1a	amylase, alpha 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-08-18	Amy1a	amylase, alpha 1A	Amy1a	amylase, alpha 1A (salivary)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Amy1a	amylase, alpha 1A (salivary)	Amy1	amylase 1, salivary	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Amy1	amylase 1, salivary		amylase 1	Name updated	1299863	APPROVED
2002-06-10	Amy1	Amylase 1			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)