Advanced Search (OLGA)

Gene: Amy2a3 (amylase 2a3) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Amy2a3

Name:

amylase 2a3

RGD ID:

1593187

Description:

Enables alpha-amylase activity. Predicted to be involved in carbohydrate catabolic process. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to several human genes including AMY1A (amylase alpha 1A); AMY1B (amylase alpha 1B); and AMY1C (amylase alpha 1C); PARTICIPATES IN starch and sucrose metabolic pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

1,4-alpha-D-glucan glucanohydrolase; Amy2; amylase 2, pancreatic; LOC100911494; PA; pancreatic alpha-amylase; pancreatic alpha-amylase-like; pancreatic amylase

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	AMY2B (amylase alpha 2B)	HGNC	HomoloGene, Panther
Homo sapiens (human):	AMY2A (amylase alpha 2A)	HGNC	Panther
Homo sapiens (human):	AMY1C (amylase alpha 1C)	HGNC	Panther
Homo sapiens (human):	AMY1B (amylase alpha 1B)	HGNC	Panther
Homo sapiens (human):	AMY1A (amylase alpha 1A)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	AMY2A (amylase alpha 2A)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY2A (amylase alpha 2A)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY2B (amylase alpha 2B)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY2B (amylase alpha 2B)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY1C (amylase alpha 1C)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY1B (amylase alpha 1B)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Homo sapiens (human):	AMY1A (amylase alpha 1A)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Amy2a1 (amylase 2a1)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Mus musculus (house mouse):	Amy2a5 (amylase 2a5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amy2a2 (amylase 2a2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amy2a3 (amylase 2a3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Amy2a4 (amylase 2a4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	amy2a (amylase alpha 2A (pancreatic))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-d	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-d	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-p	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amy-p	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C50B6.7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amyrel	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Amyrel	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	amy2b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	amy2b	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	amy2a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	204,005,840 - 204,014,412 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	204,005,840 - 204,014,413 (-)	Ensembl				GRCr8
mRatBN7.2	2	201,317,916 - 201,326,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	201,317,920 - 201,326,532 (-)	Ensembl				mRatBN7.2
Rnor_6.0	2	216,373,674 - 216,382,260 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	216,339,154 - 216,382,260 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	245,855,271 - 245,864,327 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	209,507,212 - 209,518,455 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	193,849,962 - 193,888,322 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrotoluene (EXP)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

ampicillin (EXP)

bisphenol A (EXP)

capsaicin (EXP)

devazepide (EXP)

dexamethasone (EXP)

gentamycin (EXP)

melatonin (EXP)

methimazole (EXP)

metronidazole (EXP)

neomycin (EXP)

oxybenzone (EXP)

perfluorooctanoic acid (EXP)

phenformin (EXP)

rotenone (EXP)

sodium dichromate (EXP)

tarazepide (EXP)

testosterone (EXP)

vancomycin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate catabolic process (ISS)

carbohydrate metabolic process (IBA,IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,ISS)

Molecular Function

alpha-amylase activity (IBA,IDA,IEA,IMP,ISS)

amylase activity (IEA)

calcium ion binding (ISS)

catalytic activity (IEA)

cation binding (IEA)

chloride ion binding (ISS)

hydrolase activity (IEA)

hydrolase activity, acting on glycosyl bonds (IEA)

metal ion binding (IEA)

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

starch and sucrose metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	SH3 binding sites of ZG29p mediate an interaction with amylase and are involved in condensation-sorting in the exocrine rat pancreas.	Kleene R, etal., Biochemistry. 2000 Aug 15;39(32):9893-900.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Gallated form of tea catechin, not nongallated form, increases fecal starch excretion in rats.	Unno T, etal., J Nutr Sci Vitaminol (Tokyo). 2012;58(1):45-9.

Additional References at PubMed

PMID:6159531	PMID:6168351	PMID:17980695	PMID:20981735

Genomics

Variants

Variants in Amy2a3
103 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Markers in Region

RH134907

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	2	1446.2	UniSTS
Cytogenetic Map	2	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	15	24	25	9	18	9	60	33	8	10	7	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086695 ⟹ ENSRNOP00000072892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	216,373,706 - 216,382,244 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087259 ⟹ ENSRNOP00000073932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	216,339,154 - 216,382,260 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087839 ⟹ ENSRNOP00000073403

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	216,339,186 - 216,348,194 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110965 ⟹ ENSRNOP00000083297

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	204,005,840 - 204,014,413 (-)	Ensembl
mRatBN7.2 Ensembl	2	201,317,920 - 201,326,532 (-)	Ensembl

RefSeq Acc Id:

NM_031502 ⟹ NP_113690

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	204,005,840 - 204,014,412 (-)	NCBI
mRatBN7.2	2	201,317,916 - 201,326,487 (-)	NCBI
Rnor_6.0	2	216,373,674 - 216,382,260 (-)	NCBI
Rnor_5.0	2	245,855,271 - 245,864,327 (-)	NCBI
RGSC_v3.4	2	209,507,212 - 209,518,455 (-)	RGD
Celera	2	193,849,962 - 193,888,322 (-)	RGD

Sequence:

show sequence

ACAACTTCAAAGCAAATGAAGTTCGTTCTGCTGCTTTCCCTCATTGGGTTCTGCTGGGCTCAAT
ATGACCCACACACTGCGGATGGGAGGACTGCTATTGTCCACCTGTTCGAGTGGCGCTGGGCTGA
TATTGCCAAGGAATGTGAGCGGTACTTAGCACCTAAGGGATTTGGAGGGGTGCAGGTCTCTCCA
CCCAATGAAAATATTATAATTAATAATCCATCAAGGCCTTGGTGGGAAAGATATCAACCAATCA
GCTACAAAATTTGCTCAAGGTCTGGAAATGAAAATGAATTCAAAGACATGGTGACGAGGTGCAA
CAATGTTGGTGTCCGGATTTATGTGGATGCTGTCATTAATCACATGTGTGGCTCGGGCAATAGT
GCAGGAACACACAGTACCTGTGGAAGTTACTTCAATCCTAATAACAGGGAATTCTCAGCAGTTC
CATACTCTGCTTGGTATTTTAACGATAATAAATGTAATGGAGAAATTAATAACTACAATGATGC
CAATCAGGTCAGAAATTGTCGTCTGTCTGGCCTTCTGGATCTTGCACTCGATAAAGATTATGTT
CGAACCAAGGTGGCTGACTATATGAACAATCTCATTGACATTGGTGTAGCAGGGTTCAGACTTG
ATGCTGCTAAGCACATGTGGCCTGGAGACATAAAGGCAGTTTTGGACAAACTACATAATCTAAA
TACAAAATGGTTCTCCCAAGGAAGCAGACCTTTCATTTTCCAAGAGGTCATTGATCTTGGTGGT
GAAGCAATTAAAGGTAGTGAGTACTTTGGAAATGGCCGCGTGACAGAATTCAAGTATGGTGCAA
AACTTGGCACAGTTATTCGCAAATGGAATGGAGAGAAGATGTCTTACTTAAAGAACTGGGGAGA
AGGTTGGGGTTTTGTGCCTACTGACAGAGCCCTTGTGTTTGTGGACAACCATGACAATCAGCGA
GGACATGGTGCTGGAGGAGCATCCATCCTGACATTCTGGGATGCTAGAATGTATAAAATGGCAG
TTGGATTTATGTTGGCTCATCCTTATGGATTCACCAGAGTAATGTCAAGTTACCGAAGGACAAG
AAATTTCCAGAATGGAAAAGATGTGAATGACTGGATTGGACCACCTAATAACAATGGAGTAACA
AAAGAAGTGACCATTAATCCAGACACTACTTGTGGCAATGACTGGGTCTGTGAACATCGATGGC
GTCAAATCAGGAACATGGTTGCCTTCAGGAATGTAGTCAACGGTCAGCCTTTTGCAAACTGGTG
GGATAATGGCAGCAACCAAGTGGCTTTTAGCAGAGGAAACAGAGGATTCATTGTCTTTAACAAT
GATGACTGGGCTTTGTCAAGCACTCTACAGACTGGTCTTCCTGCTGGCACATACTGTGATGTCA
TTTCAGGAGATAAAGTCAATGGCAATTGCACTGGACTTAAAGTAAATGTTGGCAGTGATGGCAA
AGCTCACTTCTCTATTAGTAACTCTGCTGAAGACCCATTCATTGCAATCCATGCCGACTCAAAG
TTGTAAGAGTCAAATTAAAGAGATTTAGATTCAGCACC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113690	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40725	(Get FASTA)	NCBI Sequence Viewer
	EDL82036	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000083297
GenBank Protein	P00689	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113690 ⟸ NM_031502
- Peptide Label:	precursor
- UniProtKB:	P00689 (UniProtKB/Swiss-Prot), A6HV60 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPPNENI IINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGSGNSAGTHS TCGSYFNPNNREFSAVPYSAWYFNDNKCNGEINNYNDANQVRNCRLSGLLDLALDKDYVRTKVA DYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKG SEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPTDRALVFVDNHDNQRGHGAG GASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRRTRNFQNGKDVNDWIGPPNNNGVTKEVTI NPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWAL SSTLQTGLPAGTYCDVISGDKVNGNCTGLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL hide sequence

Ensembl Acc Id:

ENSRNOP00000073403 ⟸ ENSRNOT00000087839

Ensembl Acc Id:

ENSRNOP00000073932 ⟸ ENSRNOT00000087259

Ensembl Acc Id:

ENSRNOP00000072892 ⟸ ENSRNOT00000086695

Ensembl Acc Id:

ENSRNOP00000083297 ⟸ ENSRNOT00000110965

Protein Domains

Alpha-amylase C-terminal Glycosyl hydrolase family 13 catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P00689-F1-model_v2	AlphaFold	P00689	1-508	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691694

Promoter ID:

EPDNEW_R2219

Type:

multiple initiation site

Name:

LOC103689940_2

Description:

pancreatic alpha-amylase-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R2218

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	216,382,258 - 216,382,318	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593187	AgrOrtholog
BioCyc Gene	G2FUF-51537	BioCyc
Ensembl Genes	ENSRNOG00000055613	Ensembl
	ENSRNOG00000065221	Ensembl
	ENSRNOG00000081566	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000110965	ENTREZGENE
Gene3D-CATH	2.60.40.1180	UniProtKB/Swiss-Prot
	Glycosidases	UniProtKB/Swiss-Prot
InterPro	A-amylase/branching_C	UniProtKB/Swiss-Prot
	A-amylase_C	UniProtKB/Swiss-Prot
	Alpha_amylase	UniProtKB/Swiss-Prot
	Glyco_hydro_13_cat_dom	UniProtKB/Swiss-Prot
	Glyco_hydro_b	UniProtKB/Swiss-Prot
	Glycoside_hydrolase_SF	UniProtKB/Swiss-Prot
KEGG Report	rno:497039	UniProtKB/Swiss-Prot
NCBI Gene	497039	ENTREZGENE
PANTHER	ALPHA-AMYLASE	UniProtKB/Swiss-Prot
Pfam	Alpha-amylase	UniProtKB/Swiss-Prot
	Alpha-amylase_C	UniProtKB/Swiss-Prot
PhenoGen	Amy2a3	PhenoGen
PRINTS	ALPHAAMYLASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000055613	RatGTEx
	ENSRNOG00000065221	RatGTEx
	ENSRNOG00000081566	RatGTEx
SMART	Aamy	UniProtKB/Swiss-Prot
	Aamy_C	UniProtKB/Swiss-Prot
Superfamily-SCOP	Glycosyl hydrolase domain	UniProtKB/Swiss-Prot
	SSF51445	UniProtKB/Swiss-Prot
UniProt	A0A8I6GAL8_RAT	UniProtKB/TrEMBL
	A6HV60	ENTREZGENE, UniProtKB/TrEMBL
	AMYP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-13	Amy2a3	amylase 2a3	LOC100911494	pancreatic alpha-amylase-like	Data merged from RGD:6492945	737654	PROVISIONAL
2013-01-29	Amy2a3	amylase 2a3	Amy2	amylase 2, pancreatic	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911494	pancreatic alpha-amylase-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	Amy2	amylase 2, pancreatic			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)