Advanced Search (OLGA)

Gene: Eif4a3 (eukaryotic translation initiation factor 4A3) Rattus norvegicus

Analyze

Symbol:

Eif4a3

Name:

eukaryotic translation initiation factor 4A3

RGD ID:

1591139

Description:

Enables RNA stem-loop binding activity; ribonucleoprotein complex binding activity; and selenocysteine insertion sequence binding activity. Involved in several processes, including cellular response to brain-derived neurotrophic factor stimulus; cellular response to selenite ion; and regulation of translation. Located in dendrite; neuronal cell body; and nucleus. Part of ribonucleoprotein complex. Is active in glutamatergic synapse. Human ortholog(s) of this gene implicated in intellectual disability. Orthologous to human EIF4A3 (eukaryotic translation initiation factor 4A3); PARTICIPATES IN spliceosome pathway; mRNA decay pathway; RNA transport pathway; INTERACTS WITH 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP-dependent RNA helicase DDX48; ATP-dependent RNA helicase eIF4A-3; DEAD box protein 48; eIF-4A-III; eIF4A-III; eukaryotic initiation factor 4A-III; eukaryotic translation initiation factor 4A, isoform 3; LOC688288; similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	105,047,568 - 105,058,207 (-)	Ensembl				GRCr8
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	109,651,698 - 109,661,700 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,114,724 - 109,124,726 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,469,667 - 104,479,661 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	10	103,096,825 - 103,106,820 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

genetic disease (ISO)

intellectual disability (ISO)

pancreatic cancer (ISO)

Richieri Costa-Pereira Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clobetasol (ISO)

clozapine (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (ISO)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dimethyl sulfoxide (ISO)

disodium selenite (EXP)

disulfiram (ISO)

ethanol (ISO)

fenvalerate (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

kainic acid (EXP)

lead(0) (ISO)

Licochalcone B (ISO)

Mesaconitine (EXP)

methimazole (EXP)

microcystin-LR (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

nitrates (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

phenol red (ISO)

propiconazole (EXP)

rac-lactic acid (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

associative learning (IEP)

cellular response to brain-derived neurotrophic factor stimulus (IEP)

cellular response to selenite ion (IEP)

embryonic cranial skeleton morphogenesis (IEA,ISO,ISS)

exploration behavior (IEP)

mRNA export from nucleus (IEA,ISO)

mRNA metabolic process (IEA,ISO)

mRNA processing (IEA)

mRNA splicing, via spliceosome (IBA,IEA,ISO,ISS)

mRNA transport (IEA)

negative regulation of excitatory postsynaptic potential (IMP)

negative regulation of gene expression (IMP)

negative regulation of selenocysteine incorporation (IDA)

negative regulation of translation (IEA,ISO)

nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO)

positive regulation of mRNA splicing, via spliceosome (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of translation (IEA,ISO)

regulation of alternative mRNA splicing, via spliceosome (ISS)

regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO)

regulation of translation (IEA)

regulation of translation at postsynapse, modulating synaptic transmission (IDA,IMP)

RNA splicing (IEA)

rRNA processing (IEA)

Cellular Component

catalytic step 2 spliceosome (IBA,IEA,ISO)

cytoplasm (IEA,ISO)

dendrite (IDA)

exon-exon junction complex (IEA,ISO)

glutamatergic synapse (IDA,IMP)

neuronal cell body (IDA)

nuclear speck (IEA)

nucleolus (IBA)

nucleoplasm (IEA,ISO)

nucleus (IDA,IEA,ISO)

postsynapse (IEA)

ribonucleoprotein complex (IDA)

spliceosomal complex (IEA)

U2-type catalytic step 1 spliceosome (IEA,ISO,ISS)

Molecular Function

ATP binding (IEA,ISO)

ATP hydrolysis activity (IEA)

helicase activity (IEA)

hydrolase activity (IEA)

mRNA binding (IBA,IEA,ISO)

nucleic acid binding (IEA)

nucleotide binding (IEA)

poly(A) binding (IEA,ISO)

protein binding (ISO)

ribonucleoprotein complex binding (IDA)

RNA binding (IEA)

RNA helicase activity (IBA,IEA,ISO)

RNA stem-loop binding (IDA)

selenocysteine insertion sequence binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

mRNA decay pathway (IEA)

RNA transport pathway (IEA)

spliceosome pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression of the core exon-junction complex factor eukaryotic initiation factor 4A3 is increased during spatial exploration and striatally-mediated learning.	Barker-Haliski ML, etal., Neuroscience. 2012 Dec 13;226:51-61. doi: 10.1016/j.neuroscience.2012.09.003. Epub 2012 Sep 12.
2.	Eukaryotic initiation factor 4a3 is a selenium-regulated RNA-binding protein that selectively inhibits selenocysteine incorporation.	Budiman ME, etal., Mol Cell. 2009 Aug 28;35(4):479-89. doi: 10.1016/j.molcel.2009.06.026.
3.	Identification of a signature motif for the eIF4a3-SECIS interaction.	Budiman ME, etal., Nucleic Acids Res. 2011 Sep 1;39(17):7730-9. doi: 10.1093/nar/gkr446. Epub 2011 Jun 17.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	The EJC factor eIF4AIII modulates synaptic strength and neuronal protein expression.	Giorgi C, etal., Cell. 2007 Jul 13;130(1):179-91.
6.	Contribution of copy number variants involving nonsense-mediated mRNA decay pathway genes to neuro-developmental disorders.	Nguyen LS, etal., Hum Mol Genet. 2013 May 1;22(9):1816-25. doi: 10.1093/hmg/ddt035. Epub 2013 Jan 31.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	The ever-increasing complexities of the exon junction complex.	Tange TO, etal., Curr Opin Cell Biol. 2004 Jun;16(3):279-84.
13.	Proteomics-based identification of DEAD-box protein 48 as a novel autoantigen, a prospective serum marker for pancreatic cancer.	Xia Q, etal., Biochem Biophys Res Commun. 2005 May 6;330(2):526-32.

Additional References at PubMed

PMID:10523622	PMID:11991638	PMID:12477932	PMID:15632090	PMID:16209946	PMID:16601204	PMID:18423201	PMID:18480465	PMID:19946888	PMID:22658674	PMID:22681889	PMID:22961380
PMID:24360810	PMID:24625528	PMID:29301961	PMID:30053369	PMID:37839527

Genomics

Comparative Map Data

Eif4a3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	105,047,568 - 105,058,207 (-)	Ensembl				GRCr8
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	109,651,698 - 109,661,700 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,114,724 - 109,124,726 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,469,667 - 104,479,661 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	10	103,096,825 - 103,106,820 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

EIF4A3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	80,134,369 - 80,147,128 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	80,134,369 - 80,147,151 (-)	Ensembl			hg38	GRCh38
GRCh37	17	78,108,168 - 78,120,927 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	75,723,612 - 75,735,533 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	75,723,612 - 75,735,533	NCBI
Celera	17	74,737,992 - 74,749,960 (-)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	73,549,709 - 73,561,680 (-)	NCBI		HuRef
CHM1_1	17	78,195,223 - 78,207,193 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	81,034,760 - 81,047,523 (-)	NCBI		T2T-CHM13v2.0

Eif4a3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	119,179,189 - 119,190,869 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	119,179,189 - 119,190,915 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	119,288,363 - 119,300,043 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	119,288,363 - 119,300,089 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	119,149,677 - 119,161,357 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	119,104,453 - 119,116,133 (-)	NCBI		MGSCv36	mm8
Celera	11	131,033,290 - 131,044,990 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.35	NCBI

Eif4a3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	2,749,534 - 2,760,873 (+)	Ensembl
ChiLan1.0	NW_004955506	2,749,534 - 2,760,873 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100988043
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	96,549,687 - 96,561,728 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	101,614,275 - 101,626,237 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	74,221,793 - 74,233,738 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

EIF4A3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	1,582,950 - 1,593,893 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	1,582,993 - 1,593,892 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	2,222,792 - 2,233,743 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	2,215,271 - 2,226,216 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	2,215,233 - 2,226,208 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	2,238,677 - 2,249,620 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	2,364,112 - 2,375,060 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	2,445,388 - 2,456,373 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eif4a3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	2,251,664 - 2,263,559 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	4,147,685 - 4,160,293 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	4,148,401 - 4,160,290 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF4A3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	2,285,579 - 2,313,874 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	2,285,679 - 2,311,750 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	2,267,492 - 2,293,229 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF4A3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	72,097,692 - 72,113,112 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	43,403,306 - 43,418,370 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif4a3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	9,240,780 - 9,250,863 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624801	9,240,780 - 9,250,864 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eif4a3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	64,731,111 - 64,741,353 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Eif4a3
50 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	29
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000073140
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat

Markers in Region

D10Got223

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,552,104 - 104,552,234 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,418,268 - 108,418,397	NCBI	Rnor6.0
Rnor_5.0	10	108,030,102 - 108,030,231	UniSTS	Rnor5.0
Celera	10	103,099,893 - 103,100,022	UniSTS

RH137027

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	105,047,655 - 105,047,928 (+)	Marker Load Pipeline
mRatBN7.2	10	104,549,126 - 104,549,399 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,415,290 - 108,415,562	NCBI	Rnor6.0
Rnor_5.0	10	108,027,124 - 108,027,396	UniSTS	Rnor5.0
Celera	10	103,096,914 - 103,097,186	UniSTS

RH129599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	105,047,594 - 105,047,902 (+)	Marker Load Pipeline
mRatBN7.2	10	104,549,065 - 104,549,373 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,415,229 - 108,415,536	NCBI	Rnor6.0
Rnor_5.0	10	108,027,063 - 108,027,370	UniSTS	Rnor5.0
Celera	10	103,096,853 - 103,097,160	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO559861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073140 ⟹ ENSRNOP00000066302

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	105,047,568 - 105,058,207 (-)	Ensembl
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095583 ⟹ ENSRNOP00000080401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	105,047,568 - 105,057,561 (-)	Ensembl
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114380 ⟹ ENSRNOP00000081737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	104,549,045 - 104,559,019 (-)	Ensembl

RefSeq Acc Id:

NM_001100158 ⟹ NP_001093628

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI
Celera	10	103,096,825 - 103,106,820 (-)	NCBI

Sequence:

show sequence

GCGAGCCTTGTTTCCGGTTCCCGCCGCAGCTCGCAGTTGTCTATTAGTGGGGTCGGGATCATGG
CGGCCACGGCCACGATGGCGACGTCGGGCTCCGCGCGGAAGCGGCTGCTCAAAGAGGAGGACAT
GACCAAAGTGGAGTTCGAGACCAGCGAGGAGGTGGACGTGACCCCCACGTTCGACACCATGGGC
CTTCGGGAGGACCTGCTGCGCGGCATCTACGCCTACGGTTTTGAAAAACCTTCTGCGATCCAAC
AGCGTGCTATCAAGCAGATAATTAAAGGGAGAGATGTCATTGCACAGTCTCAGTCTGGCACAGG
CAAGACGGCCACCTTCAGTATTTCAGTCCTTCAGTGCTTGGATATCCAGGTTCGAGAAACCCAA
GCTTTGATATTGGCTCCAACAAGAGAGTTAGCAGTGCAGATTCAGAAGGGTCTGCTTGCTTTGG
GGGATTACATGAACGTGCAGTGCCATGCCTGCATTGGTGGCACCAATGTCGGGGAGGACATCCG
GAAGCTGGACTATGGGCAGCATGTTGTGGCGGGCACACCAGGACGAGTCTTTGATATGATCCGC
CGTAGAAGTTTAAGGACACGGGCAATCAAGATGTTGGTTTTGGATGAAGCTGATGAAATGTTGA
ACAAAGGTTTCAAGGAGCAGATCTATGACGTGTACAGGTACTTGCCACCAGCCACTCAGGTTGT
TCTCATCAGCGCCACGCTGCCCCATGAGATCCTGGAGATGACCAACAAGTTCATGACCGACCCC
ATCCGCATCTTGGTGAAGCGTGATGAGTTGACTCTGGAAGGCATCAAACAGTTCTTCGTGGCCG
TGGAAAGAGAGGAATGGAAGTTCGACACTCTCTGTGATCTCTACGACACGCTGACCATCACCCA
GGCTGTCATCTTCTGCAACACCAAGAGGAAGGTTGACTGGCTGACAGAGAAAATGAGAGAAGCC
AATTTCACAGTGTCGTCCATGCACGGAGACATGCCCCAGAAAGAGCGTGAGTCCATCATGAAGG
AGTTCCGGTCAGGTGCCAGCCGAGTGCTCATCTCCACAGATGTCTGGGCGCGGGGCCTCGATGT
CCCTCAGGTGTCCCTCATCATTAACTATGACCTGCCCAACAACAGAGAACTGTACATTCACAGA
ATCGGGAGATCAGGTCGATATGGACGCAAAGGTGTGGCCATCAATTTTGTGAAGAATGATGACA
TCCGCATCCTCAGGGACATTGAGCAGTACTACTCCACCCAGATAGATGAGATGCCTATGAATGT
GGCTGACCTCATCTGAAGCTGGTGCTGGTACACCAAGGGCCTGTTTGGAGCTCCTCTTTGGACA
TGGAAGCTTCTATTTAATGGGGTTTATATGAACTGTCTTCTCATAGCCCTCAGGAGGACCCTCG
GCCTCTGCCATCTTTTCTAATGCACGTGTAAATAATCCAATGCGCTAAATCTTTTACATTAAAC
ATGGAAATTTTCCCACGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001093628	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05876	(Get FASTA)	NCBI Sequence Viewer
	EDM06783	(Get FASTA)	NCBI Sequence Viewer
	EDM06784	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066302.1
	ENSRNOP00000080401
GenBank Protein	Q3B8Q2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001093628 ⟸ NM_001100158

- UniProtKB:

Q3B8Q2 (UniProtKB/Swiss-Prot), A0A8I5ZT01 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAI
QQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLA
LGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEM
LNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV
AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIM
KEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKND
DIRILRDIEQYYSTQIDEMPMNVADLI

hide sequence

Ensembl Acc Id:

ENSRNOP00000066302 ⟸ ENSRNOT00000073140

Ensembl Acc Id:

ENSRNOP00000080401 ⟸ ENSRNOT00000095583

Ensembl Acc Id:

ENSRNOP00000081737 ⟸ ENSRNOT00000114380

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3B8Q2-F1-model_v2	AlphaFold	Q3B8Q2	1-411	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697944

Promoter ID:

EPDNEW_R8468

Type:

initiation region

Name:

Eif4a3_1

Description:

eukaryotic translation initiation factor 4A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	108,425,157 - 108,425,217	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591139	AgrOrtholog
BioCyc Gene	G2FUF-22495	BioCyc
Ensembl Genes	ENSRNOG00000045791	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073140.3	UniProtKB/Swiss-Prot
	ENSRNOT00000095583	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7130292	IMAGE-MGC_LOAD
InterPro	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot
	Helicase_ATP-bd	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	RNA-helicase_DEAD-box_CS	UniProtKB/Swiss-Prot
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:688288	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:125040	IMAGE-MGC_LOAD
NCBI Gene	688288	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE DBP3	UniProtKB/Swiss-Prot
Pfam	DEAD	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
PhenoGen	Eif4a3	PhenoGen
PROSITE	DEAD_ATP_HELICASE	UniProtKB/Swiss-Prot
	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot
	HELICASE_CTER	UniProtKB/Swiss-Prot
	Q_MOTIF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000045791	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot
	HELICc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZT01	ENTREZGENE, UniProtKB/TrEMBL
	IF4A3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-01	Eif4a3	eukaryotic translation initiation factor 4A3	Eif4a3	eukaryotic translation initiation factor 4A, isoform 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-23	Eif4a3	eukaryotic translation initiation factor 4A, isoform 3	LOC688288	similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC688288	similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)