Symbol:
Gla
Name:
galactosidase, alpha
RGD ID:
1589721
Description:
Enables alpha-galactosidase activity and galactoside binding activity. Involved in several processes, including glycosphingolipid catabolic process; platelet aggregation; and regulation of axon diameter. Predicted to be located in Golgi apparatus; extracellular space; and lysosome. Predicted to be active in cytoplasm. Used to study Fabry disease and lysosomal storage disease. Human ortholog(s) of this gene implicated in Fabry disease. Orthologous to human GLA (galactosidase alpha); PARTICIPATES IN Fabry disease pathway; galactose metabolic pathway; galactosemia pathway; INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-galactosidase A; galactosidase, alpha (mapped); Gla_mapped
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GLA (galactosidase alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Gla (galactosidase, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gla (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GLA (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GLA (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gla (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GLA (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GLA (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gla (galactosidase alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KRTAP10-8 (keratin associated protein 10-8) HGNC
OMA
Homo sapiens (human):
KRTAP10-10 (keratin associated protein 10-10) HGNC
OMA
Homo sapiens (human):
KRTAP10-12 (keratin associated protein 10-12) HGNC
OMA
Homo sapiens (human):
KRTAP10-11 (keratin associated protein 10-11) HGNC
OMA
Homo sapiens (human):
KRTAP10-3 (keratin associated protein 10-3) HGNC
OMA
Homo sapiens (human):
KRTAP10-5 (keratin associated protein 10-5) HGNC
OMA
Homo sapiens (human):
KRTAP10-2 (keratin associated protein 10-2) HGNC
OMA
Homo sapiens (human):
KRTAP10-1 (keratin associated protein 10-1) HGNC
OMA
Homo sapiens (human):
KRTAP10-9 (keratin associated protein 10-9) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Gla (galactosidase, alpha)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GLA (galactosidase alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gla (galactosidase, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gana-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5731
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG7997
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
gla
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Glaem2Mcwi
Genetic Models:
DA-Glaem2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 102,062,497 - 102,073,915 (-) NCBI GRCr8 mRatBN7.2 X 97,769,227 - 97,780,646 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 97,768,996 - 97,780,664 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 99,443,442 - 99,454,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 102,954,152 - 102,965,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 100,456,591 - 100,468,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 105,405,915 - 105,417,331 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 105,406,792 - 105,417,323 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 105,295,029 - 105,306,686 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 122,044,703 - 122,056,327 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 98,809,769 - 98,821,187 (-) NCBI Celera Cytogenetic Map X q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gla Rat 1,1-dichloroethene increases expression ISO Gla (Mus musculus) 6480464 vinylidene chloride results in increased expression of GLA mRNA CTD PMID:26682919 Gla Rat 1,2-dimethylhydrazine decreases expression ISO Gla (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GLA mRNA CTD PMID:22206623 Gla Rat 1,2-dimethylhydrazine multiple interactions ISO Gla (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of GLA mRNA] CTD PMID:22206623 Gla Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Gla (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Gla Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Gla (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Gla Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gla (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GLA mRNA CTD PMID:19465110 Gla Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GLA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GLA mRNA CTD PMID:20106945 more ... Gla Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gla (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GLA mRNA CTD PMID:21496263 Gla Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gla (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GLA mRNA CTD PMID:21570461 Gla Rat 2,3-dimethoxynaphthalene-1,4-dione increases expression ISO GLA (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Gla Rat 2-hydroxypropanoic acid decreases expression ISO GLA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GLA mRNA CTD PMID:30851411 Gla Rat 4,4'-diaminodiphenylmethane increases expression ISO Gla (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GLA mRNA CTD PMID:18648102 Gla Rat 4-hydroxyphenyl retinamide increases expression ISO Gla (Mus musculus) 6480464 Fenretinide results in increased expression of GLA mRNA CTD PMID:28973697 Gla Rat 5-fluorouracil affects response to substance ISO GLA (Homo sapiens) 6480464 GLA protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Gla Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GLA mRNA CTD PMID:30047161 Gla Rat aflatoxin B1 affects expression ISO GLA (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GLA protein CTD PMID:20106945 Gla Rat aldehydo-D-glucose increases expression ISO Gla (Mus musculus) 6480464 Glucose results in increased expression of GLA mRNA CTD PMID:17178593 Gla Rat all-trans-retinoic acid increases expression ISO GLA (Homo sapiens) 6480464 Tretinoin results in increased expression of GLA mRNA CTD PMID:33167477 Gla Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of GLA mRNA CTD PMID:30779732 Gla Rat antimony(0) increases expression ISO GLA (Homo sapiens) 6480464 Antimony results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat antirheumatic drug decreases expression ISO GLA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GLA mRNA CTD PMID:24449571 Gla Rat arsane multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat arsenic atom multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat arsenous acid increases expression ISO GLA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat benzo[a]pyrene increases expression ISO Gla (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GLA mRNA CTD PMID:19770486 more ... Gla Rat benzo[a]pyrene increases methylation ISO GLA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GLA promoter CTD PMID:27901495 Gla Rat benzo[a]pyrene increases expression ISO GLA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GLA mRNA CTD PMID:20106945 more ... Gla Rat beta-naphthoflavone increases expression ISO GLA (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of GLA mRNA CTD PMID:19737606 Gla Rat bisphenol A affects expression ISO GLA (Homo sapiens) 6480464 bisphenol A affects the expression of GLA mRNA CTD PMID:30903817 Gla Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GLA gene CTD PMID:28505145 Gla Rat bisphenol A decreases methylation ISO Gla (Mus musculus) 6480464 bisphenol A results in decreased methylation of GLA promoter CTD PMID:27312807 Gla Rat bortezomib increases expression ISO GLA (Homo sapiens) 6480464 Bortezomib results in increased expression of GLA mRNA CTD PMID:20977926 Gla Rat calcitriol decreases expression ISO GLA (Homo sapiens) 6480464 Calcitriol results in decreased expression of GLA mRNA CTD PMID:21592394 Gla Rat calcitriol multiple interactions ISO GLA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of GLA mRNA CTD PMID:21592394 Gla Rat carbamazepine affects expression ISO GLA (Homo sapiens) 6480464 Carbamazepine affects the expression of GLA mRNA CTD PMID:25979313 Gla Rat carbon nanotube decreases expression ISO Gla (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Gla Rat CGP 52608 multiple interactions ISO GLA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GLA gene] CTD PMID:28238834 Gla Rat cobalt dichloride increases expression ISO GLA (Homo sapiens) 6480464 cobaltous chloride results in increased expression of GLA mRNA CTD PMID:19320972 Gla Rat copper atom multiple interactions ISO GLA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of GLA mRNA CTD PMID:20971185 Gla Rat copper(0) multiple interactions ISO GLA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of GLA mRNA CTD PMID:20971185 Gla Rat copper(II) chloride increases expression ISO GLA (Homo sapiens) 6480464 cupric chloride results in increased expression of GLA mRNA CTD PMID:17211630 Gla Rat copper(II) sulfate increases expression ISO GLA (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GLA mRNA CTD PMID:19549813 Gla Rat coumestrol multiple interactions ISO GLA (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of GLA mRNA CTD PMID:19167446 Gla Rat coumestrol increases expression ISO GLA (Homo sapiens) 6480464 Coumestrol results in increased expression of GLA mRNA CTD PMID:19167446 Gla Rat cyclosporin A increases expression ISO GLA (Homo sapiens) 6480464 Cyclosporine results in increased expression of GLA mRNA CTD PMID:20106945 and PMID:25562108 Gla Rat cyclosporin A decreases expression ISO GLA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GLA mRNA CTD PMID:27989131 Gla Rat cyfluthrin decreases expression ISO GLA (Homo sapiens) 6480464 cyfluthrin results in decreased expression of GLA mRNA CTD PMID:31330490 Gla Rat D-glucose increases expression ISO Gla (Mus musculus) 6480464 Glucose results in increased expression of GLA mRNA CTD PMID:17178593 Gla Rat diarsenic trioxide increases expression ISO GLA (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat Dibutyl phosphate affects expression ISO GLA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GLA mRNA CTD PMID:37042841 Gla Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GLA mRNA CTD PMID:21266533 Gla Rat dicrotophos decreases expression ISO GLA (Homo sapiens) 6480464 dicrotophos results in decreased expression of GLA mRNA CTD PMID:28302478 Gla Rat dioxygen multiple interactions ISO Gla (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GLA mRNA CTD PMID:30529165 Gla Rat dioxygen decreases expression ISO GLA (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of GLA mRNA CTD PMID:35883890 Gla Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO GLA (Homo sapiens) 6480464 Antimony Potassium Tartrate results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat dorsomorphin multiple interactions ISO GLA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GLA mRNA CTD PMID:27188386 Gla Rat doxorubicin decreases expression ISO GLA (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GLA mRNA CTD PMID:29803840 Gla Rat elesclomol increases expression ISO GLA (Homo sapiens) 6480464 elesclomol results in increased expression of GLA mRNA CTD PMID:18723479 Gla Rat flutamide increases expression ISO Gla (Mus musculus) 6480464 Flutamide analog results in increased expression of GLA mRNA and Flutamide results in increased expression of GLA mRNA CTD PMID:17702527 Gla Rat folic acid multiple interactions ISO Gla (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of GLA mRNA] CTD PMID:22206623 Gla Rat formaldehyde decreases expression ISO GLA (Homo sapiens) 6480464 Formaldehyde results in decreased expression of GLA mRNA CTD PMID:23649840 Gla Rat furan increases methylation EXP 6480464 furan results in increased methylation of GLA gene CTD PMID:22079235 Gla Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GLA mRNA CTD PMID:33387578 Gla Rat glucose increases expression ISO Gla (Mus musculus) 6480464 Glucose results in increased expression of GLA mRNA CTD PMID:17178593 Gla Rat hydralazine multiple interactions ISO GLA (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GLA mRNA CTD PMID:17183730 Gla Rat hydroquinone O-beta-D-glucopyranoside multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in increased activity of GLA protein] CTD PMID:32757845 Gla Rat isoprenaline multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in increased activity of GLA protein] CTD PMID:32757845 Gla Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of GLA protein CTD PMID:32757845 Gla Rat ivermectin decreases expression ISO GLA (Homo sapiens) 6480464 Ivermectin results in decreased expression of GLA protein CTD PMID:32959892 Gla Rat manganese atom multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat manganese(0) multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat manganese(II) chloride multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat mercury atom increases expression ISO GLA (Homo sapiens) 6480464 Mercury results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat mercury(0) increases expression ISO GLA (Homo sapiens) 6480464 Mercury results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat methyl methacrylate increases expression ISO Gla (Mus musculus) 6480464 Methylmethacrylate results in increased expression of GLA mRNA CTD PMID:16916219 Gla Rat migalastat multiple interactions ISO GLA (Homo sapiens) 6480464 [GLA protein mutant form binds to GLA protein mutant form] which results in decreased susceptibility to migalastat CTD PMID:22773828 Gla Rat N-nitrosodimethylamine increases expression ISO GLA (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat nickel dichloride increases expression ISO GLA (Homo sapiens) 6480464 nickel chloride results in increased expression of GLA mRNA CTD PMID:17547211 Gla Rat O-methyleugenol increases expression ISO GLA (Homo sapiens) 6480464 methyleugenol results in increased expression of GLA mRNA CTD PMID:32234424 Gla Rat okadaic acid increases expression ISO GLA (Homo sapiens) 6480464 Okadaic Acid results in increased expression of GLA mRNA CTD PMID:38832940 Gla Rat ozone decreases expression ISO GLA (Homo sapiens) 6480464 Ozone results in decreased expression of GLA mRNA CTD PMID:23033980 Gla Rat paracetamol increases expression ISO GLA (Homo sapiens) 6480464 Acetaminophen results in increased expression of GLA mRNA CTD PMID:21420995 Gla Rat paracetamol increases expression ISO Gla (Mus musculus) 6480464 Acetaminophen results in increased expression of GLA mRNA CTD PMID:29246445 Gla Rat paracetamol multiple interactions ISO Gla (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of GLA mRNA] CTD PMID:29246445 Gla Rat paracetamol decreases expression ISO GLA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GLA mRNA CTD PMID:26690555 Gla Rat perfluorooctanoic acid decreases expression ISO GLA (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of GLA mRNA CTD PMID:36326898 Gla Rat phenobarbital affects expression ISO GLA (Homo sapiens) 6480464 Phenobarbital affects the expression of GLA mRNA CTD PMID:19159669 Gla Rat phenylephrine affects response to substance ISO Gla (Mus musculus) 6480464 GLA protein affects the susceptibility to Phenylephrine CTD PMID:18565198 Gla Rat phenylmercury acetate increases expression ISO GLA (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GLA mRNA CTD PMID:26272509 Gla Rat phenylmercury acetate multiple interactions ISO GLA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GLA mRNA CTD PMID:27188386 Gla Rat pirinixic acid increases expression ISO Gla (Mus musculus) 6480464 pirinixic acid results in increased expression of GLA mRNA CTD PMID:18301758 Gla Rat piroxicam decreases expression ISO GLA (Homo sapiens) 6480464 Piroxicam results in decreased expression of GLA mRNA CTD PMID:21858171 Gla Rat propiconazole increases expression ISO Gla (Mus musculus) 6480464 propiconazole results in increased expression of GLA mRNA CTD PMID:21278054 Gla Rat quercetin increases expression ISO GLA (Homo sapiens) 6480464 Quercetin results in increased expression of GLA mRNA CTD PMID:21632981 Gla Rat rac-lactic acid decreases expression ISO GLA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GLA mRNA CTD PMID:30851411 Gla Rat resveratrol multiple interactions ISO GLA (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of GLA mRNA CTD PMID:19167446 Gla Rat rotenone increases expression ISO Gla (Mus musculus) 6480464 Rotenone results in increased expression of GLA mRNA CTD PMID:17702527 Gla Rat SB 431542 multiple interactions ISO GLA (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GLA mRNA CTD PMID:27188386 Gla Rat serotonin affects response to substance ISO Gla (Mus musculus) 6480464 GLA protein affects the susceptibility to Serotonin CTD PMID:18565198 Gla Rat silicon dioxide increases expression ISO Gla (Mus musculus) 6480464 Silicon Dioxide results in increased expression of GLA mRNA CTD PMID:19073995 more ... Gla Rat silver atom increases expression ISO GLA (Homo sapiens) 6480464 Silver results in increased expression of GLA mRNA CTD PMID:26014281 Gla Rat silver(0) increases expression ISO GLA (Homo sapiens) 6480464 Silver results in increased expression of GLA mRNA CTD PMID:26014281 Gla Rat sodium arsenite increases expression ISO GLA (Homo sapiens) 6480464 sodium arsenite results in increased expression of GLA mRNA CTD PMID:28595984 and PMID:38568856 Gla Rat sodium arsenite decreases expression ISO Gla (Mus musculus) 6480464 sodium arsenite results in decreased expression of GLA mRNA CTD PMID:37668303 Gla Rat sodium arsenite multiple interactions ISO GLA (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GLA mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GLA mRNA CTD PMID:39836092 Gla Rat sodium arsenite affects expression ISO GLA (Homo sapiens) 6480464 sodium arsenite affects the expression of GLA mRNA CTD PMID:34032870 Gla Rat Soman increases expression EXP 6480464 Soman results in increased expression of GLA mRNA CTD PMID:19281266 Gla Rat sulforaphane increases expression ISO GLA (Homo sapiens) 6480464 sulforaphane results in increased expression of GLA mRNA CTD PMID:31838189 Gla Rat sunitinib decreases expression ISO GLA (Homo sapiens) 6480464 Sunitinib results in decreased expression of GLA mRNA CTD PMID:31533062 Gla Rat tert-butyl hydroperoxide increases expression ISO Gla (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of GLA mRNA CTD PMID:14729362 Gla Rat testosterone decreases expression ISO GLA (Homo sapiens) 6480464 Testosterone results in decreased expression of GLA mRNA CTD PMID:21592394 Gla Rat testosterone multiple interactions ISO GLA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of GLA mRNA CTD PMID:21592394 Gla Rat tetrachloromethane affects expression ISO Gla (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GLA mRNA CTD PMID:17484886 Gla Rat tetrachloromethane increases expression ISO Gla (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GLA mRNA CTD PMID:31919559 Gla Rat thapsigargin increases expression ISO GLA (Homo sapiens) 6480464 Thapsigargin results in increased expression of GLA mRNA CTD PMID:29453283 Gla Rat thiram increases expression ISO GLA (Homo sapiens) 6480464 Thiram results in increased expression of GLA mRNA CTD PMID:38568856 Gla Rat tremolite asbestos increases expression ISO Gla (Mus musculus) 6480464 tremolite results in increased expression of GLA mRNA CTD PMID:29279043 Gla Rat triphenyl phosphate affects expression ISO GLA (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GLA mRNA CTD PMID:37042841 Gla Rat tunicamycin decreases expression ISO GLA (Homo sapiens) 6480464 Tunicamycin results in decreased expression of GLA mRNA CTD PMID:22378314 Gla Rat valproic acid affects expression ISO Gla (Mus musculus) 6480464 Valproic Acid affects the expression of GLA mRNA CTD PMID:17292431 Gla Rat valproic acid affects expression ISO GLA (Homo sapiens) 6480464 Valproic Acid affects the expression of GLA mRNA CTD PMID:25979313 Gla Rat valproic acid increases expression ISO GLA (Homo sapiens) 6480464 Valproic Acid results in increased expression of GLA mRNA CTD PMID:23179753 and PMID:29154799 Gla Rat valproic acid multiple interactions ISO GLA (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GLA mRNA CTD PMID:17183730 Gla Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GLA mRNA CTD PMID:19015723 Gla Rat zalcitabine multiple interactions EXP 6480464 [gp120 protein and Human immunodeficiency virus 1 co-treated with Zalcitabine] results in decreased expression of GLA mRNA CTD PMID:18606552 Gla Rat zoledronic acid decreases expression ISO GLA (Homo sapiens) 6480464 zoledronic acid results in decreased expression of GLA protein CTD PMID:28871336
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) antimony(0) (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) cyfluthrin (ISO) D-glucose (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) dorsomorphin (ISO) doxorubicin (ISO) elesclomol (ISO) flutamide (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) glucose (ISO) hydralazine (ISO) hydroquinone O-beta-D-glucopyranoside (EXP) isoprenaline (EXP) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury atom (ISO) mercury(0) (ISO) methyl methacrylate (ISO) migalastat (ISO) N-nitrosodimethylamine (ISO) nickel dichloride (ISO) O-methyleugenol (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylephrine (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) piroxicam (ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) serotonin (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thiram (ISO) tremolite asbestos (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) zalcitabine (EXP) zoledronic acid (ISO)
1.
Fabry disease: six gene rearrangements and an exonic point mutation in the alpha-galactosidase gene.
Bernstein HS, etal., J Clin Invest. 1989 Apr;83(4):1390-9.
2.
HomeCageScan analysis reveals ongoing pain in Fabry rats.
Burand AJ, etal., Neurobiol Pain. 2023 Jan 5;13:100113. doi: 10.1016/j.ynpai.2022.100113. eCollection 2023 Jan-Jul.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Platelet and myeloid cell phenotypes in a rat model of Fabry disease.
Kanack AJ, etal., FASEB J. 2021 Aug;35(8):e21818. doi: 10.1096/fj.202001727RR.
5.
α-Galactosidase A-deficient rats accumulate glycosphingolipids and develop cardiorenal phenotypes of Fabry disease.
Miller JJ, etal., FASEB J. 2019 Jan;33(1):418-429. doi: 10.1096/fj.201800771R. Epub 2018 Jul 6.
6.
Neuropathic pain in a Fabry disease rat model.
Miller JJ, etal., JCI Insight. 2018 Mar 22;3(6). pii: 99171. doi: 10.1172/jci.insight.99171.
7.
Rats deficient in α-galactosidase A develop ocular manifestations of Fabry disease.
Miller JJ, etal., Sci Rep. 2019 Jun 28;9(1):9392. doi: 10.1038/s41598-019-45837-1.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
Alterations in certain lysosomal glycohydrolases and cathepsins in rats on dexamethasone administration.
Rajashree S and Puvanakrishnan R, Mol Cell Biochem. 1996 Jan 26;154(2):165-70.
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Rat brain contains high levels of mannose-6-phosphorylated glycoproteins including lysosomal enzymes and palmitoyl-protein thioesterase, an enzyme implicated in infantile neuronal lipofuscinosis.
Sleat DE, etal., J Biol Chem. 1996 Aug 9;271(32):19191-8.
16.
Sensory-specific peripheral nerve pathology in a rat model of Fabry disease.
Waltz TB, etal., Neurobiol Pain. 2021 Sep 2;10:100074. doi: 10.1016/j.ynpai.2021.100074. eCollection 2021 Aug-Dec.
Gla Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 102,062,497 - 102,073,915 (-) NCBI GRCr8 mRatBN7.2 X 97,769,227 - 97,780,646 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 97,768,996 - 97,780,664 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 99,443,442 - 99,454,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 102,954,152 - 102,965,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 100,456,591 - 100,468,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 105,405,915 - 105,417,331 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 105,406,792 - 105,417,323 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 105,295,029 - 105,306,686 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 122,044,703 - 122,056,327 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 98,809,769 - 98,821,187 (-) NCBI Celera Cytogenetic Map X q32 NCBI
GLA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 101,397,803 - 101,407,925 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 101,393,273 - 101,408,012 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 100,652,791 - 100,662,913 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 100,539,435 - 100,549,657 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 100,458,941 - 100,469,096 NCBI Celera X 101,172,239 - 101,182,459 (-) NCBI Celera Cytogenetic Map X q22.1 NCBI HuRef X 90,459,075 - 90,468,889 (-) NCBI HuRef CHM1_1 X 100,546,260 - 100,556,479 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 99,841,918 - 99,852,040 (-) NCBI T2T-CHM13v2.0
Gla Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 133,488,912 - 133,501,707 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 133,488,898 - 133,501,874 (-) Ensembl GRCm39 Ensembl GRCm38 X 134,588,169 - 134,601,005 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 134,588,149 - 134,601,125 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 131,122,708 - 131,135,544 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 129,934,706 - 129,947,305 (-) NCBI MGSCv36 mm8 Celera X 117,467,753 - 117,480,561 (-) NCBI Celera Cytogenetic Map X E3 NCBI cM Map X 56.2 NCBI
Gla Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955503 7,521,930 - 7,535,817 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955503 7,526,077 - 7,535,817 (-) NCBI ChiLan1.0 ChiLan1.0
GLA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 100,997,182 - 101,007,409 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 101,000,787 - 101,010,979 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 90,600,412 - 90,610,594 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 100,732,311 - 100,742,280 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 100,732,311 - 100,742,280 (-) Ensembl panpan1.1 panPan2
GLA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 75,311,536 - 75,320,391 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 75,311,536 - 75,320,249 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 X 76,731,752 - 76,740,708 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 76,731,752 - 76,740,486 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 74,296,077 - 74,305,030 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 75,956,280 - 75,965,243 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 75,718,710 - 75,727,662 (-) NCBI UU_Cfam_GSD_1.0
Gla
GLA
GLA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 89,738,097 - 89,749,740 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 89,737,966 - 89,750,539 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 14,657,735 - 14,667,684 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gla
.
Predicted Target Of
Count of predictions: 399 Count of miRNA genes: 220 Interacting mature miRNAs: 275 Transcripts: ENSRNOT00000015494 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
RH140281
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 97,768,844 - 97,768,996 (+) MAPPER mRatBN7.2 Rnor_6.0 X 105,405,533 - 105,405,684 NCBI Rnor6.0 Rnor_5.0 X 105,294,887 - 105,295,038 UniSTS Rnor5.0 RGSC_v3.4 X 122,044,513 - 122,044,664 UniSTS RGSC3.4 Celera X 98,809,387 - 98,809,538 UniSTS Cytogenetic Map X q34 UniSTS
RH130891
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 102,062,296 - 102,062,483 (+) Marker Load Pipeline mRatBN7.2 X 97,769,026 - 97,769,213 (+) MAPPER mRatBN7.2 Rnor_6.0 X 105,405,715 - 105,405,901 NCBI Rnor6.0 Rnor_5.0 X 105,295,069 - 105,295,255 UniSTS Rnor5.0 RGSC_v3.4 X 122,044,695 - 122,044,881 UniSTS RGSC3.4 Celera X 98,809,569 - 98,809,755 UniSTS RH 3.4 Map 1 942.6 UniSTS Cytogenetic Map X q34 UniSTS
BE118467
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 97,770,604 - 97,770,788 (+) MAPPER mRatBN7.2 Rnor_6.0 X 105,407,293 - 105,407,476 NCBI Rnor6.0 Rnor_5.0 X 105,296,647 - 105,296,830 UniSTS Rnor5.0 RGSC_v3.4 X 122,046,273 - 122,046,456 UniSTS RGSC3.4 Celera X 98,811,147 - 98,811,330 UniSTS RH 3.4 Map 1 943.1 UniSTS Cytogenetic Map X q34 UniSTS
This gene Gla is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015494 ⟹ ENSRNOP00000015494
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 97,768,996 - 97,780,664 (-) Ensembl Rnor_6.0 Ensembl X 105,406,792 - 105,417,323 (-) Ensembl
RefSeq Acc Id:
NM_001108820 ⟹ NP_001102290
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 102,062,497 - 102,073,915 (-) NCBI mRatBN7.2 X 97,769,227 - 97,780,646 (-) NCBI Rnor_6.0 X 105,405,915 - 105,417,331 (-) NCBI Rnor_5.0 X 105,295,029 - 105,306,686 (-) NCBI RGSC_v3.4 X 122,044,703 - 122,056,327 (-) RGD Celera X 98,809,769 - 98,821,187 (-) NCBI
Sequence:
GGATTTCTATGGCCATGAAGCTTTTGAGCGGAGATACACCGCTGGTCTGTGAGCTTGCGCTTCGCCCCCTGGCTTTAGTTTTCTGGAGCATTCTTGGGGCCAGAGCATTGGACAATGGCTTGGCGCGG
hide sequence
RefSeq Acc Id:
NP_001102290 ⟸ NM_001108820
- UniProtKB:
D3ZJF9 (UniProtKB/TrEMBL), A6IVG1 (UniProtKB/TrEMBL)
- Sequence:
MAMKLLSGDTPLVCELALRPLALVFWSILGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDACISEQLFMQMAELMVSDGWRDAGYEYLCIDDCWMAPERDSKGRLQADPKRFPSGIKHLANYVHS
hide sequence
Ensembl Acc Id:
ENSRNOP00000015494 ⟸ ENSRNOT00000015494
RGD ID: 13701935 Promoter ID: EPDNEW_R12459 Type: multiple initiation site Name: Gla_1 Description: galactosidase, alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 105,417,343 - 105,417,403 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2007-04-13
galactosidase, alpha
Gla
galactosidase, alpha (mapped)
Name updated
737654 APPROVED
2007-04-11
Gla
galactosidase, alpha (mapped)
Gla_mapped
galactosidase, alpha (mapped)
Data merged from RGD:2698
737654 APPROVED
2006-11-19
Gla
galactosidase, alpha (mapped)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-11-17
Gla_mapped
galactosidase, alpha (mapped)
Gla
galactosidase, alpha
Symbol and Name updated
1556543 APPROVED
2002-06-10
Gla
Galactosidase, alpha
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
mutation of the human homolog causes Fabry disease, a disorder of glycosphingolipid catabolism
1300216
