Spx (spexin hormone) - Rat Genome Database

Name: Spx
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Spx (spexin hormone) Rattus norvegicus

Analyze

Symbol:

Spx

Name:

spexin hormone

RGD ID:

1587448

Description:

Predicted to enable neuropeptide hormone activity; type 2 galanin receptor binding activity; and type 3 galanin receptor binding activity. Involved in several processes, including long-chain fatty acid import into cell; negative regulation of appetite; and negative regulation of renal sodium excretion. Located in cytoplasm. Orthologous to human SPX (spexin hormone); INTERACTS WITH 17beta-estradiol; bisphenol A; testosterone.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC691138; liver regeneration-related protein LRRGT00060; LOC691138; LRRGT00060; neuropeptide Q; Npq; spexin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPX (spexin hormone)	HGNC	Ensembl, HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Spx (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spx (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPX (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPX (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPX (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPX (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spx (spexin hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR51G2 (olfactory receptor family 51 subfamily G member 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SPX (spexin hormone)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spx (spexin hormone)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spx (spexin hormone)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,087,053 - 177,093,091 (+)	NCBI		GRCr8
mRatBN7.2	4	175,356,044 - 175,362,082 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,356,247 - 175,362,082 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	181,650,891 - 181,656,929 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,435,164 - 177,441,200 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,055,727 - 176,061,763 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	176,629,597 - 176,635,698 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,629,800 - 176,641,008 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	240,843,758 - 240,849,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	179,975,336 - 179,980,842 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	163,888,558 - 163,894,628 (+)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

dilated cardiomyopathy 1O (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dorsomorphin (ISO)

entinostat (ISO)

genistein (ISO)

lipopolysaccharide (ISO)

N-Nitrosopyrrolidine (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (EXP)

Theaflavin 3,3'-digallate (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

long-chain fatty acid import into cell (IDA,ISO)

negative regulation of appetite (IDA,ISO)

negative regulation of heart rate (IDA)

negative regulation of renal sodium excretion (IDA)

positive regulation of gastro-intestinal system smooth muscle contraction (IBA,ISO,ISS)

positive regulation of systemic arterial blood pressure (IDA)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

regulation of sensory perception of pain (IDA)

signal transduction (IEA)

Cellular Component

cytoplasm (IBA,IDA)

dense core granule (ISO,ISS)

extracellular space (IBA,ISO,ISS)

transport vesicle (IEA)

Molecular Function

neuropeptide hormone activity (IBA,ISO,ISS)

protein binding (ISO)

type 2 galanin receptor binding (ISO,ISS)

type 3 galanin receptor binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification of novel peptide hormones in the human proteome by hidden Markov model screening.	Mirabeau O, etal., Genome Res. 2007 Mar;17(3):320-7. Epub 2007 Feb 6.
3.	Spexin expression in normal rat tissues.	Porzionato A, etal., J Histochem Cytochem. 2010 Sep;58(9):825-37. doi: 10.1369/jhc.2010.956300. Epub 2010 Jun 7.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Peptides derived from the prohormone proNPQ/spexin are potent central modulators of cardiovascular and renal function and nociception.	Toll L, etal., FASEB J. 2012 Feb;26(2):947-54. doi: 10.1096/fj.11-192831. Epub 2011 Oct 28.
6.	Spexin is a novel human peptide that reduces adipocyte uptake of long chain fatty acids and causes weight loss in rodents with diet-induced obesity.	Walewski JL, etal., Obesity (Silver Spring). 2014 Jul;22(7):1643-52. doi: 10.1002/oby.20725. Epub 2014 Mar 8.

Additional References at PubMed

PMID:19193193	PMID:20045034	PMID:23080164	PMID:24517231	PMID:31396649	PMID:33632048	PMID:33928538

Genomics

Comparative Map Data

Spx
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,087,053 - 177,093,091 (+)	NCBI		GRCr8
mRatBN7.2	4	175,356,044 - 175,362,082 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,356,247 - 175,362,082 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	181,650,891 - 181,656,929 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,435,164 - 177,441,200 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,055,727 - 176,061,763 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	176,629,597 - 176,635,698 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,629,800 - 176,641,008 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	240,843,758 - 240,849,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	179,975,336 - 179,980,842 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	163,888,558 - 163,894,628 (+)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

SPX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	21,526,296 - 21,532,947 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	21,526,296 - 21,541,249 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	21,679,230 - 21,685,881 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	21,570,523 - 21,575,477 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	12	26,834,644 - 26,839,598 (+)	NCBI		Celera
Cytogenetic Map	12	p12.1	NCBI
HuRef	12	21,453,255 - 21,458,209 (+)	NCBI		HuRef
CHM1_1	12	21,644,862 - 21,649,814 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	21,405,263 - 21,411,916 (+)	NCBI		T2T-CHM13v2.0

Spx
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	142,359,114 - 142,365,466 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	142,359,167 - 142,365,456 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	142,413,388 - 142,419,740 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	142,413,441 - 142,419,730 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	142,361,961 - 142,367,091 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	142,371,234 - 142,376,962 (+)	NCBI		MGSCv36	mm8
Celera	6	145,473,941 - 145,479,073 (+)	NCBI		Celera
Cytogenetic Map	6	G2	NCBI
cM Map	6	74.03	NCBI

Spx
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	17,173,215 - 17,178,388 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	17,173,215 - 17,178,388 (+)	NCBI	ChiLan1.0	ChiLan1.0

SPX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	75,270,239 - 75,275,011 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	75,266,637 - 75,271,410 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	64,766,136 - 64,771,728 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	67,369,413 - 67,375,680 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	67,369,413 - 67,375,630 (-)	Ensembl	panpan1.1		panPan2

SPX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	25,561,636 - 25,572,310 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	25,563,606 - 25,571,093 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	20,780,749 - 20,789,452 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	25,791,296 - 25,799,202 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	25,792,502 - 25,818,889 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	25,584,197 - 25,592,099 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	25,604,663 - 25,615,317 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	20,957,128 - 20,965,827 (+)	NCBI		UU_Cfam_GSD_1.0

SPX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	51,920,400 - 51,941,598 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	51,919,474 - 51,929,204 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	55,196,569 - 55,205,161 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	21,391,660 - 21,401,860 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	21,392,621 - 21,396,923 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666069	13,746,535 - 13,757,244 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spx
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	17,147,925 - 17,152,430 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	17,146,644 - 17,154,855 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Spx
49 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	157710145	182687754	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	3	56	27	26	16	5	16	3	37	13	50	6	21	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001083933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC134270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY383715	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086529 ⟹ ENSRNOP00000068862

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	176,629,975 - 176,641,008 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087378 ⟹ ENSRNOP00000071461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	175,356,247 - 175,362,082 (+)	Ensembl
Rnor_6.0 Ensembl	4	176,629,800 - 176,634,504 (+)	Ensembl

RefSeq Acc Id:

NM_001083933 ⟹ NP_001077402

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	177,087,053 - 177,093,091 (+)	NCBI
mRatBN7.2	4	175,356,044 - 175,362,082 (+)	NCBI
Rnor_6.0	4	176,629,597 - 176,635,698 (+)	NCBI
Rnor_5.0	4	240,843,758 - 240,849,264 (+)	NCBI
RGSC_v3.4	4	179,975,336 - 179,980,842 (+)	RGD
Celera	4	163,888,558 - 163,894,628 (+)	NCBI

Sequence:

show sequence

GGGTGGGAACATGAAGGGGCCGAGCATCCTGGCCGTGGCAGCCTTGGCCCTTCTCCTGGTGCTG
TCTGTTCTGGAAAACTCCAGCGGTGCTCCGCAGAGACTCTCTGAGAAGAGGAACTGGACTCCCC
AAGCCATGCTCTATCTGAAGGGCGCACAGGGCCACCGCTTCATCTCAGACCAGAGTCGCAGGAA
GGAGCTTGCAGACCGGCCGCCTCCAGAAAGACGAAACCCAAATCTTCAACTGCTGACTCTCCCA
GAGGCTGCAGCCCTGTTTCTGGCTTCCTTGGAAAAACCACAAAAAGATGAAGGAGGGGATTTTG
ATAAAAGCAAACTCCTGGAAGACAGACGCTTTTACTGGTGAAAATGCAGTAGGCCGTCGTCAAG
TGTGCTTCTAGTCATGATGAAAACCGGAACCATGTGAAAGGGGCCCCTGCACCCTCCCTTCCCC
CTTAGACAGCTGCACCCTTAGGTTTAGTCACATGGACCTCTTGGCTGGAACACCACCATGTTCT
GCTGCGTTGGCTTGGCATCACCCATGTCTTACATAGGCTTGGATCTCCTAGGGCCTTTCACGTG
TCAAGGCTTAGGACTCAGAAATGTTCTTTCTTTTCCCACAGTCAGGCCCTATCTTGATCTTGGC
TGTTTGTTTTCTGATCCCATTTCTCTCTTGCCTTTGGTGCCACTCAGCAGTAAATCTCGTTGTT
CCTCCTTTTCCTATCCCCTGGAAGAGAGAGGGTACATCAGGAAGGGAGTGGATAGTATGTCTCT
TTGTAACTCATCTTGGAGAGGTCAATTAAGGAGGGGGGCGAGGAGAAGATGCCCTTATAAAGCT
CCCACAAAAACACATCTCTGTCACTGCTCAGATGGGGACCCTCAGTGATGCTCAAACCCTTGGA
AGGTCTGTGAAGACCCAAGACCGGGAGCCTCTTTGTCTTCCTAAGAGATCTAACTGAATTCCAC
ATAGAAACTTGGACCTTAAGATACCGGCATATAAGCAGATGGTATTGGAAGAGTTTGCTGGAGC
ATATGGCACAAAAAGGGACAAACCAGTTGTTCGGGTTCAGAGGTAGCCCGTTTTCTATAGCTGA
AAGGTACTCCATCATGACTTTACATTAAGGCATTCCTATGACACATGTGCATGCCATATGTACT
TTTCCATGCACACACGTATGCATGCACACACACACACACACACACACACACACACACACACACA
CATTCACATGAACATGCACACAATGGTGGAATTTGGGAGTGAGATCCCTATAGCAAGGAGACTG
ACTTGTTTGGACTTATTTTGGAATTATATCATGCTCACCATGGGTGGTTTTTTTCTTACCTACT
CAGTTCAGAGTCATTAACAATAAGTGCACAAGTGACAAGTAGTGATACTTACTGTCCTCAGCTT
ACAGCTATTACCTTGTAACTACACAGTATCTTTATGTAAATACTTCTGTAATCTGATGTTTTAA
CCCAACTGTGTGAAGTAATCAAAGCCATGTGTATATGTTTTGTCTGCTTCTCAGTTCATAATTA
AATAATAAAACTATACTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001077402	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ96273	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071461.1
	ENSRNOP00055013618
	ENSRNOP00060011986
	ENSRNOP00065006108
GenBank Protein	M0R8L2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001077402 ⟸ NM_001083933
- Peptide Label:	precursor
- UniProtKB:	Q6TXE0 (UniProtKB/Swiss-Prot), M0R8L2 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKGPSILAVAALALLLVLSVLENSSGAPQRLSEKRNWTPQAMLYLKGAQGHRFISDQSRRKELA DRPPPERRNPNLQLLTLPEAAALFLASLEKPQKDEGGDFDKSKLLEDRRFYW hide sequence

Ensembl Acc Id:

ENSRNOP00000071461 ⟸ ENSRNOT00000087378

Ensembl Acc Id:

ENSRNOP00000068862 ⟸ ENSRNOT00000086529

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R8L2-F1-model_v2	AlphaFold	M0R8L2	1-116	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1587448	AgrOrtholog
BioCyc Gene	G2FUF-42493	BioCyc
Ensembl Genes	ENSRNOG00000053700	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055009997	UniProtKB/Swiss-Prot
	ENSRNOG00060009139	UniProtKB/Swiss-Prot
	ENSRNOG00065005783	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000087378.2	UniProtKB/Swiss-Prot
	ENSRNOT00055016913	UniProtKB/Swiss-Prot
	ENSRNOT00060015385	UniProtKB/Swiss-Prot
	ENSRNOT00065008645	UniProtKB/Swiss-Prot
InterPro	Spexin	UniProtKB/Swiss-Prot
KEGG Report	rno:691138	UniProtKB/Swiss-Prot
NCBI Gene	691138	ENTREZGENE
PANTHER	PTHR28590	UniProtKB/Swiss-Prot
	SPEXIN	UniProtKB/Swiss-Prot
Pfam	Spexin	UniProtKB/Swiss-Prot
PhenoGen	Spx	PhenoGen
RatGTEx	ENSRNOG00000053700	RatGTEx
	ENSRNOG00055009997	RatGTEx
	ENSRNOG00060009139	RatGTEx
	ENSRNOG00065005783	RatGTEx
UniProt	M0R8L2	ENTREZGENE
	Q6TXE0	ENTREZGENE
	SPXN_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q6TXE0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-04-23	Spx	spexin hormone	LOC691138	hypothetical protein LOC691138	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	LOC691138	hypothetical protein LOC691138	LOC686427	hypothetical protein LOC686427	Data merged from RGD:1597657	1643240	APPROVED
2006-11-20	LOC686427	hypothetical protein LOC686427			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC691138	hypothetical protein LOC691138			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar