Tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog) - Rat Genome Database

Tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog) Rattus norvegicus

Subscribe to Updates

Symbol:

Tamm41

Name:

TAM41 mitochondrial translocator assembly and maintenance homolog

RGD ID:

1586150

Description:

Enables phosphatidate cytidylyltransferase activity. Predicted to be involved in CDP-diacylglycerol biosynthetic process and cardiolipin biosynthetic process. Located in mitochondrial inner membrane. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 56. Orthologous to human TAMM41 (TAM41 mitochondrial translocator assembly and maintenance homolog); PARTICIPATES IN cardiolipin biosynthetic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

Previously known as:

CDP-DAG synthase; CDP-diacylglycerol synthase; hypothetical protein LOC362419; LOC103694579; LOC362419; mitochondrial translocator assembly and maintenance protein 41 homolog; MMP37-like protein, mitochondrial; phosphatidate cytidylyltransferase, mitochondrial; similar to CG33331-PA; TAM41; TAM41, mitochondrial translocator assembly and maintenance protein, homolog; TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae); uncharacterized LOC103694579

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	149,743,216 - 149,776,388 (-)	NCBI		GRCr8
mRatBN7.2	4	148,070,388 - 148,103,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,018,463 - 148,103,694 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	154,296,081 - 154,328,796 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,079,140 - 150,111,859 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	148,702,961 - 148,735,676 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	146,922,085 - 146,954,159 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	146,922,085 - 146,954,159 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	210,211,579 - 210,243,653 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	151,138,678 - 151,171,829 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	136,965,822 - 136,998,658 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	combined oxidative phosphorylation deficiency		ISO	TAMM41 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Combined oxidative phosphorylation deficiency	ClinVar	PMID:25741868 and PMID:35321494
Tamm41	Rat	combined oxidative phosphorylation deficiency 56		ISO	TAMM41 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 and PMID:35321494
Tamm41	Rat	Deglutition Disorders		ISO	TAMM41 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dysphagia	ClinVar	PMID:35321494
Tamm41	Rat	Muscle Hypotonia		ISO	TAMM41 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neonatal hypotonia	ClinVar	PMID:25741868 and PMID:35321494
Tamm41	Rat	Neurodevelopmental Disorders		ISO	TAMM41 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	combined oxidative phosphorylation deficiency 56		ISO	TAMM41 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TAMM41 mRNA]	CTD	PMID:31150632
Tamm41	Rat	1,2-dichloroethane	decreases expression	ISO	Tamm41 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of TAMM41 mRNA	CTD	PMID:28960355
Tamm41	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Tamm41 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TAMM41 mRNA	CTD	PMID:22206623
Tamm41	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of TAMM41 mRNA	CTD	PMID:33387578
Tamm41	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of TAMM41 protein	CTD	PMID:34915118
Tamm41	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Tamm41 (Mus musculus)	6480464	Fenretinide results in increased expression of TAMM41 mRNA	CTD	PMID:28973697
Tamm41	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of TAMM41 mRNA	CTD	PMID:30047161
Tamm41	Rat	aflatoxin B1	increases expression	ISO	TAMM41 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of TAMM41 mRNA	CTD	PMID:27153756
Tamm41	Rat	aristolochic acid A	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of TAMM41 mRNA	CTD	PMID:33212167
Tamm41	Rat	arsenite(3-)	increases expression	ISO	Tamm41 (Mus musculus)	6480464	arsenite results in increased expression of TAMM41 protein	CTD	PMID:37955338
Tamm41	Rat	benzo[a]pyrene	affects methylation	ISO	TAMM41 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of TAMM41 promoter	CTD	PMID:27901495
Tamm41	Rat	benzo[a]pyrene	increases expression	ISO	TAMM41 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of TAMM41 protein	CTD	PMID:33278487
Tamm41	Rat	bicalutamide	increases expression	ISO	TAMM41 (Homo sapiens)	6480464	bicalutamide results in increased expression of TAMM41 mRNA	CTD	PMID:16631469
Tamm41	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TAMM41 mRNA	CTD	PMID:25181051
Tamm41	Rat	bisphenol A	affects methylation	ISO	Tamm41 (Mus musculus)	6480464	bisphenol A affects the methylation of TAMM41 promoter	CTD	PMID:27334623
Tamm41	Rat	carbon nanotube	increases expression	ISO	Tamm41 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
Tamm41	Rat	chlorpyrifos	increases expression	ISO	Tamm41 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of TAMM41 mRNA	CTD	PMID:37019170
Tamm41	Rat	copper atom	multiple interactions	ISO	TAMM41 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of TAMM41 mRNA	CTD	PMID:20971185
Tamm41	Rat	copper(0)	multiple interactions	ISO	TAMM41 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of TAMM41 mRNA	CTD	PMID:20971185
Tamm41	Rat	copper(II) sulfate	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of TAMM41 mRNA	CTD	PMID:19549813
Tamm41	Rat	dioxygen	multiple interactions	ISO	Tamm41 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TAMM41 mRNA	CTD	PMID:30529165
Tamm41	Rat	doxorubicin	decreases expression	ISO	Tamm41 (Mus musculus)	6480464	Doxorubicin results in decreased expression of TAMM41 mRNA	CTD	PMID:26873546
Tamm41	Rat	doxorubicin	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of TAMM41 mRNA	CTD	PMID:29803840
Tamm41	Rat	folic acid	multiple interactions	ISO	Tamm41 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TAMM41 mRNA	CTD	PMID:22206623
Tamm41	Rat	isobutanol	multiple interactions	ISO	TAMM41 (Homo sapiens)	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of TAMM41 mRNA	CTD	PMID:29432896
Tamm41	Rat	ivermectin	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Ivermectin results in decreased expression of TAMM41 protein	CTD	PMID:32959892
Tamm41	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of TAMM41 mRNA	CTD	PMID:30047161
Tamm41	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of TAMM41 gene	CTD	PMID:35440735
Tamm41	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of TAMM41 mRNA	CTD	PMID:25729387
Tamm41	Rat	paracetamol	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of TAMM41 mRNA	CTD	PMID:25704631
Tamm41	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Tamm41 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of TAMM41 mRNA	CTD	PMID:37995155
Tamm41	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of TAMM41 mRNA	CTD	PMID:30047161
Tamm41	Rat	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of TAMM41 mRNA	CTD	PMID:30047161
Tamm41	Rat	rotenone	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Rotenone results in decreased expression of TAMM41 mRNA	CTD	PMID:29955902
Tamm41	Rat	sodium arsenite	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of TAMM41 mRNA	CTD	PMID:38568856
Tamm41	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of TAMM41 mRNA	CTD	PMID:30047161
Tamm41	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TAMM41 mRNA]	CTD	PMID:31150632
Tamm41	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of TAMM41 mRNA	CTD	PMID:31150632
Tamm41	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of TAMM41 mRNA	CTD	PMID:34492290
Tamm41	Rat	thiram	decreases expression	ISO	TAMM41 (Homo sapiens)	6480464	Thiram results in decreased expression of TAMM41 mRNA	CTD	PMID:38568856
Tamm41	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of TAMM41 mRNA	CTD	PMID:25729387
Tamm41	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of TAMM41 mRNA	CTD	PMID:33387578
Tamm41	Rat	triphenyl phosphate	affects expression	ISO	TAMM41 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of TAMM41 mRNA	CTD	PMID:37042841
Tamm41	Rat	triptonide	decreases expression	ISO	Tamm41 (Mus musculus)	6480464	triptonide results in decreased expression of TAMM41 mRNA	CTD	PMID:33045310
Tamm41	Rat	tungsten	increases expression	ISO	Tamm41 (Mus musculus)	6480464	Tungsten results in increased expression of TAMM41 mRNA	CTD	PMID:30912803

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	biological_process		ND		1598407	09/2017: no relevant rat data	RGD
Tamm41	Rat	cardiolipin biosynthetic process	involved_in	IEA	InterPro:IPR015222	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tamm41	Rat	cardiolipin biosynthetic process	involved_in	IBA	PANTHER:PTN000341245 and SGD:S000003278	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tamm41	Rat	CDP-diacylglycerol biosynthetic process	involved_in	IEA	UniPathway:UPA00557	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Tamm41	Rat	CDP-diacylglycerol biosynthetic process	involved_in	IBA	PANTHER:PTN000341245 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tamm41	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tamm41	Rat	phospholipid biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0594	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tamm41	Rat	mitochondrial inner membrane	located_in	IDA		14402439	PMID:29253589	UniProt
Tamm41	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-SubCell:SL-0168	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tamm41	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-KW:KW-0999	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tamm41	Rat	mitochondrion	is_active_in	ISO	TAMM41 (Homo sapiens)	1624291	PMID:38322995	RGD	PMID:38322995
Tamm41	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tamm41	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN000341245 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	nucleotidyltransferase activity	enables	IEA	UniProtKB-KW:KW-0548	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tamm41	Rat	phosphatidate cytidylyltransferase activity	enables	IDA		14402439	PMID:29253589	UniProt
Tamm41	Rat	phosphatidate cytidylyltransferase activity	enables	IEA	InterPro:IPR015222	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tamm41	Rat	phosphatidate cytidylyltransferase activity	enables	IEA	RHEA:16229	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Tamm41	Rat	phosphatidate cytidylyltransferase activity	enables	IEA	EC:2.7.7.41	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Tamm41	Rat	phosphatidate cytidylyltransferase activity	enables	IBA	PANTHER:PTN000341245 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tamm41	Rat	protein binding	enables	ISO	TAMM41 (Homo sapiens)	1624291	UniProtKB:P06744 and PMID:27499296	RGD	PMID:27499296
Tamm41	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tamm41	Rat	cardiolipin biosynthetic pathway		ISO	TAMM41 (Homo sapiens)	10400850		RGD

BioCyc Pathways

CDP-diacylglycerol biosynthesis I

#	Reference Title	Reference Citation
1.	Mitochondrial CDP-diacylglycerol synthase activity is due to the peripheral protein, TAMM41 and not due to the integral membrane protein, CDP-diacylglycerol synthase 1.	Blunsom NJ, etal., Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Mar;1863(3):284-298. doi: 10.1016/j.bbalip.2017.12.005. Epub 2017 Dec 16.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Metabolism and function of mitochondrial cardiolipin.	Ren M, etal., Prog Lipid Res. 2014 Jul;55:1-16. doi: 10.1016/j.plipres.2014.04.001. Epub 2014 Apr 24.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:14651853	PMID:18614015	PMID:34800366

Tamm41
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	149,743,216 - 149,776,388 (-)	NCBI		GRCr8
mRatBN7.2	4	148,070,388 - 148,103,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	148,018,463 - 148,103,694 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	154,296,081 - 154,328,796 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	150,079,140 - 150,111,859 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	148,702,961 - 148,735,676 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	146,922,085 - 146,954,159 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	146,922,085 - 146,954,159 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	210,211,579 - 210,243,653 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	151,138,678 - 151,171,829 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	136,965,822 - 136,998,658 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TAMM41
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	11,721,896 - 11,846,885 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	11,790,442 - 11,846,919 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	11,831,916 - 11,888,359 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	11,806,919 - 11,863,352 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	11,767,171 - 11,823,599 (-)	NCBI		Celera
Cytogenetic Map	3	p25.2	NCBI
HuRef	3	11,765,083 - 11,821,439 (-)	NCBI		HuRef
CHM1_1	3	11,781,947 - 11,838,914 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	11,717,623 - 11,842,634 (-)	NCBI		T2T-CHM13v2.0

Tamm41
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	114,981,342 - 115,014,890 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	114,981,342 - 115,014,837 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	115,004,381 - 115,037,929 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	115,004,381 - 115,037,876 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	114,954,399 - 114,987,892 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	114,970,000 - 115,003,493 (-)	NCBI		MGSCv36	mm8
Celera	6	116,842,297 - 116,875,811 (-)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	53.14	NCBI

Tamm41
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	14,452,531 - 14,500,287 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955429	14,452,473 - 14,500,441 (-)	NCBI	ChiLan1.0	ChiLan1.0

TAMM41
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	11,716,003 - 11,840,782 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	11,720,132 - 11,845,534 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	11,655,271 - 11,780,497 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	12,068,067 - 12,124,535 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	12,068,067 - 12,124,535 (-)	Ensembl	panpan1.1		panPan2

TAMM41
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	6,650,347 - 6,703,407 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	6,653,026 - 6,709,922 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	6,689,071 - 6,739,976 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	6,679,865 - 6,732,435 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	6,682,547 - 6,732,426 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	6,400,911 - 6,450,672 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	6,755,799 - 6,807,007 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	6,727,103 - 6,776,945 (+)	NCBI		UU_Cfam_GSD_1.0

Tamm41
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	17,178,646 - 17,214,847 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936602	1,694,881 - 1,726,616 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAMM41
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	67,922,480 - 67,983,526 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	67,922,476 - 67,983,526 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	75,136,048 - 75,197,048 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAMM41
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	47,798,325 - 47,855,262 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	47,798,290 - 47,854,946 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	118,660,310 - 118,729,849 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tamm41
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624943	26,409 - 72,206 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624943	26,241 - 88,233 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Tamm41
139 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	97
Count of miRNA genes:	85
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000010397
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat

D4Rat141

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	149,763,204 - 149,763,391 (+)	Marker Load Pipeline
mRatBN7.2	4	148,090,542 - 148,090,731 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	146,942,075 - 146,942,261	NCBI	Rnor6.0
Rnor_5.0	4	210,231,569 - 210,231,755	UniSTS	Rnor5.0
RGSC_v3.4	4	151,158,666 - 151,158,853	RGD	RGSC3.4
RGSC_v3.4	4	151,158,667 - 151,158,853	UniSTS	RGSC3.4
RGSC_v3.1	4	151,403,508 - 151,403,694	RGD
Celera	4	136,985,799 - 136,985,985	UniSTS
RH 3.4 Map	4	952.1	RGD
RH 3.4 Map	4	952.1	UniSTS
RH 2.0 Map	4	935.1	RGD
SHRSP x BN Map	4	72.4899	RGD
FHH x ACI Map	4	87.92	RGD
Cytogenetic Map	4	q42	UniSTS

RH139416

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	53,579,187 - 53,579,339 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	148,094,847 - 148,094,998 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	146,946,378 - 146,946,528	NCBI	Rnor6.0
Rnor_6.0	3	55,032,663 - 55,032,814	NCBI	Rnor6.0
Rnor_5.0	4	210,235,872 - 210,236,022	UniSTS	Rnor5.0
Rnor_5.0	3	61,648,015 - 61,648,166	UniSTS	Rnor5.0
RGSC_v3.4	4	151,162,970 - 151,163,120	UniSTS	RGSC3.4
RGSC_v3.4	3	50,925,142 - 50,925,293	UniSTS	RGSC3.4
Celera	3	53,142,902 - 53,143,053	UniSTS
Celera	4	136,990,102 - 136,990,252	UniSTS
Cytogenetic Map	4	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005503260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010397 ⟹ ENSRNOP00000010397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	148,018,463 - 148,103,694 (-)	Ensembl
Rnor_6.0 Ensembl	4	146,922,085 - 146,954,159 (-)	Ensembl

RefSeq Acc Id:

NM_001108642 ⟹ NP_001102112

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,743,216 - 149,776,369 (-)	NCBI
mRatBN7.2	4	148,070,552 - 148,103,711 (-)	NCBI
Rnor_6.0	4	146,922,085 - 146,954,159 (-)	NCBI
Rnor_5.0	4	210,211,579 - 210,243,653 (-)	NCBI
RGSC_v3.4	4	151,138,678 - 151,171,829 (-)	RGD
Celera	4	136,965,822 - 136,998,658 (-)	RGD

Sequence:

show sequence

GGGCCGGGCGGAAGCGCGGTCCGCACGACCGAGAATTGCGAGCACAGGGTCCGCACAGCACCCTCTGTCCTACTGGCGGGCCAGCCCGCCCATGGCGCTGCAGGCGCTGCACAGCTCGGGCGTGGGCC
TGCGCAGGATTCTGGCTCACTTCCCGGAGGACCTGAGTTTGGCCTTCGCCTACGGCTCTGCGGTGTATCGCCAGGCAGGACCCAGTGCACACCAGGAGAATCCCATGTTAGATCTAGTGTTCACAGTA
GATGACCCTGTTGCCTGGCATGCAATGAACCTGAAGAAGAACTGGAGCCACTACTCTCTCCTCAAACTCTTGGGGCCCAGGATCATCTCATCCGTCCAGAATAATTATGGTGCCGGCGTCTACTTCAA
CCCACTGATCATGTGTGACGGGAAGCTTATCAAATATGGGGTCATTAGCACTGGCACTCTGATTGAGGACCTCCTGAACTGGAATAACCTATATATCGCCGGACGTCTCCAAAAGCCGGTGAAGATTG
TATCGATGAATGAGAGCACAGTTCTTAGAGCTGCCCTGGATAAAAACCTGAAGAGTGCGGTGACCACCGCCTGCCTCATGCTACCCGAAAGCTTCTCTGAGGAAGACCTATTCATAGAGATTGCTGGG
CTCTCCTACTCAGGTGACTTCCGAATGGTGATTGGAGAAGAGAAAGCCAAAGTGTTGAACATCGTGAAGCCCAACGTAGTCCATTTCCGAGAGCTCTATGAGAGCATATTACAGAAGGACCCTCAGAT
GGTGTATAAGATGCATCAGGGCCAACTGGAGATAGATAAAAGCCCAGAAGGACAGTTCACTCAGCTAATGACATTGCCTAGAACGTTACAGCAGCATATCAATCACATCATGGACCCTCCTGGGAGAA
ACAGGGATGTGGAAGAGACTTTACTGCAAGTGGCTCAGGACCCCGACTGTGGTGACGTGGTACGACTAGCGGTCTCTTCAATCGTCAGACCTTCCAGCATCAGGCAGAGCACCAAAGGCCTTTTTACT
GCTGGTGTGAAGAAGTCTGTGATTTATAGTTCACGGAAACTGAACAAAATGTGGAAAGGGTGGGTGAGAAAAACATCCTGACTTGACTGATGTGTTACGGGTAGATTATGAATAAATGGCTCCATGCT
TTTTGACAAGAGTTGCTTGTCACTCTGGCTGACTGCTT

hide sequence

RefSeq Acc Id:

XM_039107859 ⟹ XP_038963787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,743,243 - 149,776,387 (-)	NCBI
mRatBN7.2	4	148,070,579 - 148,103,728 (-)	NCBI

RefSeq Acc Id:

XM_039107860 ⟹ XP_038963788

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,755,039 - 149,776,388 (-)	NCBI
mRatBN7.2	4	148,082,392 - 148,103,695 (-)	NCBI

RefSeq Acc Id:

XM_039107861 ⟹ XP_038963789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,749,199 - 149,769,353 (-)	NCBI
mRatBN7.2	4	148,070,388 - 148,096,692 (-)	NCBI

RefSeq Acc Id:

XM_063286305 ⟹ XP_063142375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,749,199 - 149,776,387 (-)	NCBI

RefSeq Acc Id:

XR_005503260

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	149,749,743 - 149,776,387 (-)	NCBI
mRatBN7.2	4	148,070,584 - 148,103,695 (-)	NCBI


Protein RefSeqs	NP_001102112	(Get FASTA)	NCBI Sequence Viewer
	XP_038963787	(Get FASTA)	NCBI Sequence Viewer
	XP_038963788	(Get FASTA)	NCBI Sequence Viewer
	XP_038963789	(Get FASTA)	NCBI Sequence Viewer
	XP_063142375	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZKT0	(Get FASTA)	NCBI Sequence Viewer
	EDM02163	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010397.4
	ENSRNOP00000102152

RefSeq Acc Id:

NP_001102112 ⟸ NM_001108642

- UniProtKB:

D3ZKT0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALQALHSSGVGLRRILAHFPEDLSLAFAYGSAVYRQAGPSAHQENPMLDLVFTVDDPVAWHAMNLKKNWSHYSLLKLLGPRIISSVQNNYGAGVYFNPLIMCDGKLIKYGVISTGTLIEDLLNWNNL
YIAGRLQKPVKIVSMNESTVLRAALDKNLKSAVTTACLMLPESFSEEDLFIEIAGLSYSGDFRMVIGEEKAKVLNIVKPNVVHFRELYESILQKDPQMVYKMHQGQLEIDKSPEGQFTQLMTLPRTLQ
QHINHIMDPPGRNRDVEETLLQVAQDPDCGDVVRLAVSSIVRPSSIRQSTKGLFTAGVKKSVIYSSRKLNKMWKGWVRKTS

hide sequence

Ensembl Acc Id:

ENSRNOP00000010397 ⟸ ENSRNOT00000010397

RefSeq Acc Id:	XP_038963789 ⟸ XM_039107861
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038963787 ⟸ XM_039107859
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038963788 ⟸ XM_039107860
- Peptide Label:	isoform X3

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZKT0-F1-model_v2	AlphaFold	D3ZKT0	1-337	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Tamm41_1

Description:

TAM41 mitochondrial translocator assembly and maintenance homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	146,954,144 - 146,954,204	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-43330	BioCyc
BioCyc Pathway	PWY-5667 [CDP-diacylglycerol biosynthesis I]	BioCyc
BioCyc Pathway Image	PWY-5667	BioCyc
Ensembl Genes	ENSRNOG00000007874	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010397.6	UniProtKB/Swiss-Prot
	ENSRNOT00000136613	ENTREZGENE
	ENSRNOT00000166481	ENTREZGENE
InterPro	Tam41	UniProtKB/Swiss-Prot
KEGG Report	rno:362419	UniProtKB/Swiss-Prot
NCBI Gene	362419	ENTREZGENE
PANTHER	PHOSPHATIDATE CYTIDYLYLTRANSFERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR13619	UniProtKB/Swiss-Prot
Pfam	Tam41_Mmp37	UniProtKB/Swiss-Prot
PhenoGen	Tamm41	PhenoGen
PIRSF	Mmp37	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007874	RatGTEx
UniProt	D3ZKT0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Tamm41	TAM41 mitochondrial translocator assembly and maintenance homolog	LOC103694579	uncharacterized LOC103694579	Data merged from RGD:9296506	737654	PROVISIONAL
2015-10-01	Tamm41	TAM41 mitochondrial translocator assembly and maintenance homolog	Tamm41	TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103694579	uncharacterized LOC103694579			Symbol and Name status set to provisional	70820	PROVISIONAL
2011-09-02	Tamm41	TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)	LOC362419	similar to CG33331-PA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC362419	similar to CG33331-PA			Symbol and Name status set to provisional	70820	PROVISIONAL