Supt5h (SPT5 homolog, DSIF elongation factor subunit) - Rat Genome Database

Supt5h (SPT5 homolog, DSIF elongation factor subunit) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Supt5h (SPT5 homolog, DSIF elongation factor subunit) Rattus norvegicus

Subscribe to Updates

Symbol:

Supt5h

Name:

SPT5 homolog, DSIF elongation factor subunit

RGD ID:

1563807

Description:

Predicted to enable several functions, including chromatin binding activity; enzyme binding activity; and protein heterodimerization activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of DSIF complex. Orthologous to human SUPT5H (SPT5 homolog, DSIF elongation factor subunit); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription elongation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

Previously known as:

suppressor of Ty 5 homolog; suppressor of Ty 5 homolog (S. cerevisiae); transcription elongation factor SPT5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	92,714,276 - 92,745,489 (-)	NCBI		GRCr8
mRatBN7.2	1	83,586,713 - 83,616,971 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	88,998,987 - 89,028,238 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,457,333 - 97,486,505 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	90,754,847 - 90,784,099 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	85,437,780 - 85,466,854 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	85,437,780 - 85,466,854 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	86,651,790 - 86,680,457 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,433,056 - 83,434,029 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	77,985,530 - 78,013,882 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	Carpenter syndrome 2		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Carpenter syndrome 2	ClinVar	PMID:28492532
Supt5h	Rat	congenital hypoplastic anemia		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital hypoplastic anemia	ClinVar	PMID:28492532
Supt5h	Rat	craniosynostosis 1		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: TWIST1-related craniosynostosis	ClinVar	PMID:28492532
Supt5h	Rat	Diamond-Blackfan anemia		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aase syndrome	ClinVar	PMID:28492532
Supt5h	Rat	maple syrup urine disease		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Maple syrup urine disease	ClinVar	PMID:28492532
Supt5h	Rat	maturity-onset diabetes of the young type 1		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Type 2 diabetes mellitus	ClinVar	PMID:28492532
Supt5h	Rat	type 2 diabetes mellitus		ISO	SUPT5H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Type 2 diabetes mellitus	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	17alpha-ethynylestradiol	affects expression	ISO	Supt5 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of SUPT5H mRNA	CTD	PMID:17555576
Supt5h	Rat	17alpha-ethynylestradiol	increases expression	ISO	Supt5 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of SUPT5H mRNA	CTD	PMID:17942748
Supt5h	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of SUPT5H mRNA	CTD	PMID:26496021
Supt5h	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	SUPT5H (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Supt5h	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SUPT5H mRNA	CTD	PMID:22298810
Supt5h	Rat	2,4,6-tribromophenol	decreases expression	ISO	SUPT5H (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Supt5h	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of SUPT5H mRNA	CTD	PMID:21346803
Supt5h	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of SUPT5H mRNA	CTD	PMID:21346803
Supt5h	Rat	2-methylcholine	affects expression	ISO	SUPT5H (Homo sapiens)	6480464	beta-methylcholine affects the expression of SUPT5H mRNA	CTD	PMID:21179406
Supt5h	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	SUPT5H (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of SUPT5H protein	CTD	PMID:31675489
Supt5h	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of SUPT5H mRNA	CTD	PMID:30047161
Supt5h	Rat	actinomycin D	multiple interactions	ISO	SUPT5H (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of SUPT5H protein	CTD	PMID:38460933
Supt5h	Rat	aflatoxin B1	increases expression	ISO	Supt5 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of SUPT5H mRNA	CTD	PMID:19770486
Supt5h	Rat	alvocidib	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	alvocidib inhibits the reaction [IFNB1 protein promotes the reaction [SUPT5H protein binds to IFIT1 promoter]] more ...	CTD	PMID:23589332
Supt5h	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of SUPT5H mRNA	CTD	PMID:30047161
Supt5h	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of SUPT5H mRNA	CTD	PMID:16483693
Supt5h	Rat	aristolochic acid A	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	aristolochic acid I results in increased expression of SUPT5H mRNA	CTD	PMID:33212167
Supt5h	Rat	atrazine	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Atrazine results in increased expression of SUPT5H mRNA	CTD	PMID:22378314
Supt5h	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of SUPT5H mRNA	CTD	PMID:26496021
Supt5h	Rat	bisphenol A	decreases methylation	ISO	SUPT5H (Homo sapiens)	6480464	bisphenol A results in decreased methylation of SUPT5H gene	CTD	PMID:31601247
Supt5h	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SUPT5H mRNA	CTD	PMID:30816183 more ...
Supt5h	Rat	caffeine	increases phosphorylation	ISO	SUPT5H (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of SUPT5H protein	CTD	PMID:35688186
Supt5h	Rat	carbon nanotube	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	[Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in increased expression of SUPT5 protein	CTD	PMID:34864091
Supt5h	Rat	clofibrate	decreases expression	ISO	Supt5 (Mus musculus)	6480464	Clofibrate results in decreased expression of SUPT5H mRNA	CTD	PMID:17585979
Supt5h	Rat	clofibrate	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SUPT5H mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SUPT5H mRNA]	CTD	PMID:17585979
Supt5h	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SUPT5H mRNA	CTD	PMID:17602206
Supt5h	Rat	cocaine	affects expression	EXP		6480464	Cocaine affects the expression of SUPT5H mRNA	CTD	PMID:20187946
Supt5h	Rat	coumarin	affects phosphorylation	ISO	SUPT5H (Homo sapiens)	6480464	coumarin affects the phosphorylation of SUPT5H protein	CTD	PMID:35688186
Supt5h	Rat	crocidolite asbestos	increases expression	ISO	Supt5 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of SUPT5 mRNA	CTD	PMID:29279043
Supt5h	Rat	cyclosporin A	increases expression	ISO	Supt5 (Mus musculus)	6480464	Cyclosporine results in increased expression of SUPT5H mRNA	CTD	PMID:19770486
Supt5h	Rat	cyclosporin A	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Cyclosporine results in increased expression of SUPT5H mRNA	CTD	PMID:25562108
Supt5h	Rat	dibutyl phthalate	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	[Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in increased expression of SUPT5 protein	CTD	PMID:34864091
Supt5h	Rat	dicrotophos	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	dicrotophos results in increased expression of SUPT5H mRNA	CTD	PMID:28302478
Supt5h	Rat	elemental selenium	multiple interactions	ISO	SUPT5H (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in increased expression of SUPT5H mRNA	CTD	PMID:19244175
Supt5h	Rat	elemental selenium	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Selenium results in increased expression of SUPT5H mRNA	CTD	PMID:19244175
Supt5h	Rat	ethanol	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	Ethanol affects the expression of and affects the splicing of SUPT5 mRNA	CTD	PMID:30319688
Supt5h	Rat	FR900359	decreases phosphorylation	ISO	SUPT5H (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of SUPT5H protein	CTD	PMID:37730182
Supt5h	Rat	gallic acid	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Gallic Acid results in increased expression of SUPT5H mRNA	CTD	PMID:34408198
Supt5h	Rat	geraniol	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	geraniol results in increased expression of SUPT5H mRNA	CTD	PMID:27683099
Supt5h	Rat	ivermectin	decreases expression	ISO	SUPT5H (Homo sapiens)	6480464	Ivermectin results in decreased expression of SUPT5H protein	CTD	PMID:32959892
Supt5h	Rat	methamphetamine	increases expression	ISO	Supt5 (Mus musculus)	6480464	Methamphetamine results in increased expression of SUPT5H mRNA	CTD	PMID:26307267
Supt5h	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of SUPT5H mRNA	CTD	PMID:30047161
Supt5h	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	Supt5 (Mus musculus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of SUPT5 protein	CTD	PMID:26558463
Supt5h	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SUPT5H mRNA	CTD	PMID:17602206
Supt5h	Rat	nitrates	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SUPT5 mRNA	CTD	PMID:35964746
Supt5h	Rat	Nutlin-3	multiple interactions	ISO	SUPT5H (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of SUPT5H protein	CTD	PMID:38460933
Supt5h	Rat	paracetamol	multiple interactions	ISO	Supt5 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SUPT5H mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SUPT5H mRNA]	CTD	PMID:17585979
Supt5h	Rat	paracetamol	affects expression	ISO	Supt5 (Mus musculus)	6480464	Acetaminophen affects the expression of SUPT5H mRNA	CTD	PMID:17562736
Supt5h	Rat	pentachlorophenol	increases expression	ISO	Supt5 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of SUPT5H mRNA	CTD	PMID:23892564
Supt5h	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of SUPT5H mRNA	CTD	PMID:30047161
Supt5h	Rat	selenium atom	multiple interactions	ISO	SUPT5H (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in increased expression of SUPT5H mRNA	CTD	PMID:19244175
Supt5h	Rat	selenium atom	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Selenium results in increased expression of SUPT5H mRNA	CTD	PMID:19244175
Supt5h	Rat	sodium arsenite	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	sodium arsenite results in increased expression of SUPT5H mRNA	CTD	PMID:38568856
Supt5h	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of SUPT5H mRNA	CTD	PMID:30047161
Supt5h	Rat	tamoxifen	affects expression	ISO	Supt5 (Mus musculus)	6480464	Tamoxifen affects the expression of SUPT5H mRNA	CTD	PMID:17555576
Supt5h	Rat	tetrachloromethane	increases expression	ISO	Supt5 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of SUPT5 mRNA and Carbon Tetrachloride results in increased expression of SUPT5H mRNA	CTD	PMID:27339419 and PMID:31919559
Supt5h	Rat	thiram	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Thiram results in increased expression of SUPT5H mRNA	CTD	PMID:38568856
Supt5h	Rat	titanium dioxide	decreases methylation	ISO	Supt5 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SUPT5H gene	CTD	PMID:35295148
Supt5h	Rat	triphenyl phosphate	affects expression	ISO	SUPT5H (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SUPT5H mRNA	CTD	PMID:37042841
Supt5h	Rat	Triptolide	increases expression	ISO	Supt5 (Mus musculus)	6480464	triptolide results in increased expression of SUPT5 mRNA	CTD	PMID:32835833
Supt5h	Rat	triptonide	increases expression	ISO	Supt5 (Mus musculus)	6480464	triptonide results in increased expression of SUPT5 mRNA	CTD	PMID:33045310
Supt5h	Rat	tungsten	decreases expression	ISO	Supt5 (Mus musculus)	6480464	Tungsten results in decreased expression of SUPT5 mRNA	CTD	PMID:30912803
Supt5h	Rat	urethane	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Urethane results in increased expression of SUPT5H mRNA	CTD	PMID:28818685
Supt5h	Rat	valproic acid	increases methylation	ISO	SUPT5H (Homo sapiens)	6480464	Valproic Acid results in increased methylation of SUPT5H gene	CTD	PMID:29154799
Supt5h	Rat	vitamin E	multiple interactions	ISO	SUPT5H (Homo sapiens)	6480464	[Selenium co-treated with Vitamin E] results in increased expression of SUPT5H mRNA	CTD	PMID:19244175
Supt5h	Rat	vitamin E	increases expression	ISO	SUPT5H (Homo sapiens)	6480464	Vitamin E results in increased expression of SUPT5H mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	negative regulation of DNA-templated transcription, elongation	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:10075709 and PMID:9450929	RGD	PMID:10075709 and PMID:9450929
Supt5h	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:10075709 and PMID:9450929	RGD	PMID:10075709 and PMID:9450929
Supt5h	Rat	positive regulation of DNA-templated transcription, elongation	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:9450929	RGD	PMID:9450929
Supt5h	Rat	positive regulation of macroautophagy	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:22354037	RGD	PMID:22354037
Supt5h	Rat	positive regulation of transcription by RNA polymerase II		IMP		9588536		RGD
Supt5h	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:9450929	RGD	PMID:9450929
Supt5h	Rat	regulation of transcription elongation by RNA polymerase II	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:9450929	RGD	PMID:9450929
Supt5h	Rat	transcription elongation by RNA polymerase II	involved_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:10075709 and PMID:9450929	RGD	PMID:10075709 and PMID:9450929
Supt5h	Rat	transcription elongation by RNA polymerase II	involved_in	IBA	FB:FBgn0040273 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt5h	Rat	transcription elongation-coupled chromatin remodeling	involved_in	IEA	InterPro:IPR006645	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	DSIF complex	part_of	ISO	SUPT5H (Homo sapiens)	1624291	PMID:19860741 and PMID:9450929	RGD	PMID:19860741 and PMID:9450929
Supt5h	Rat	DSIF complex	part_of	IBA	FB:FBgn0040273 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt5h	Rat	nucleoplasm	located_in	ISO	SUPT5H (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Supt5h	Rat	nucleus	located_in	ISO	SUPT5H (Homo sapiens)	1624291	PMID:10075709 and PMID:9450929	RGD	PMID:10075709 and PMID:9450929

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	chromatin binding	enables	ISO	Supt5 (Mus musculus)	1624291	PMID:21670248	RGD	PMID:21670248
Supt5h	Rat	enzyme binding	enables	ISO	SUPT5H (Homo sapiens)	1624291	UniProtKB:P24928 and PMID:10075709	RGD	PMID:10075709
Supt5h	Rat	mRNA binding	enables	IBA	FB:FBgn0040273 and PANTHER:PTN000122628	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt5h	Rat	protein binding	enables	ISO	SUPT5H (Homo sapiens)	1624291	UniProtKB:A5PJW8 more ...	RGD	PMID:10075709 more ...
Supt5h	Rat	protein heterodimerization activity	enables	ISO	SUPT5H (Homo sapiens)	1624291	UniProtKB:P63272 and PMID:9450929	RGD	PMID:9450929

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt5h	Rat	RNA polymerase I transcription pathway		ISO	SUPT5H (Homo sapiens)	9588244		RGD
Supt5h	Rat	RNA polymerase II transcription elongation pathway		ISO	SUPT5H (Homo sapiens)	9681735		RGD

#	Reference Title	Reference Citation
1.	A monoclonal autoantibody which promotes central nervous system remyelination is highly polyreactive to multiple known and novel antigens.	Asakura K, etal., J Neuroimmunol 1996 Mar;65(1):11-9.
2.	Transcription elongation factors are involved in programming hormone production in pituitary neuroendocrine GH4C1 cells.	Fujita T, etal., Mol Cell Endocrinol. 2010 May 5;319(1-2):63-70. doi: 10.1016/j.mce.2010.01.020. Epub 2010 Jan 25.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Control of transcriptional elongation.	Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	RNA polymerase I activity is regulated at multiple steps in the transcription cycle: recent insights into factors that influence transcription elongation.	Schneider DA Gene. 2012 Feb 10;493(2):176-84. doi: 10.1016/j.gene.2011.08.006. Epub 2011 Aug 26.

PMID:9450929	PMID:10075709	PMID:11596118	PMID:12477932	PMID:16778019	PMID:19575011	PMID:21670248	PMID:22354037	PMID:22658674	PMID:22681889

Supt5h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	92,714,276 - 92,745,489 (-)	NCBI		GRCr8
mRatBN7.2	1	83,586,713 - 83,616,971 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	88,998,987 - 89,028,238 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,457,333 - 97,486,505 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	90,754,847 - 90,784,099 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	85,437,780 - 85,466,854 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	85,437,780 - 85,466,854 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	86,651,790 - 86,680,457 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,433,056 - 83,434,029 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	77,985,530 - 78,013,882 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

SUPT5H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	39,445,582 - 39,476,670 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	39,436,156 - 39,476,670 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	39,936,222 - 39,967,310 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	44,628,164 - 44,659,150 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	44,628,163 - 44,659,146	NCBI
Celera	19	36,737,890 - 36,769,015 (+)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	36,382,774 - 36,413,888 (+)	NCBI		HuRef
CHM1_1	19	39,936,824 - 39,967,943 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	42,249,844 - 42,280,929 (+)	NCBI		T2T-CHM13v2.0

Supt5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	28,014,316 - 28,038,341 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	28,014,316 - 28,038,171 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	28,314,891 - 28,338,804 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	28,314,891 - 28,338,746 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	29,099,913 - 29,123,738 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	28,023,654 - 28,047,479 (-)	NCBI		MGSCv36	mm8
Celera	7	22,876,535 - 22,900,354 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	16.68	NCBI

Supt5h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	95,181 - 123,147 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	95,997 - 123,005 (-)	NCBI	ChiLan1.0	ChiLan1.0

SUPT5H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	45,739,186 - 45,772,352 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	47,611,755 - 47,642,916 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	36,543,998 - 36,575,161 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	45,092,075 - 45,122,335 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	45,092,075 - 45,122,335 (+)	Ensembl	panpan1.1		panPan2

SUPT5H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	113,759,419 - 113,788,490 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	113,759,423 - 113,788,447 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	113,163,184 - 113,192,230 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	114,360,336 - 114,389,453 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	114,336,273 - 114,389,434 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	113,919,385 - 113,948,409 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	113,552,396 - 113,581,431 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	114,546,802 - 114,576,065 (-)	NCBI		UU_Cfam_GSD_1.0

Supt5h
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	13,852,258 - 13,880,016 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	2,280,285 - 2,308,780 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	2,280,390 - 2,308,085 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUPT5H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	48,095,041 - 48,125,119 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	48,095,001 - 48,125,120 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	43,834,849 - 43,864,980 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUPT5H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	34,052,587 - 34,086,022 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	34,052,577 - 34,085,782 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	12,073,636 - 12,107,025 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Supt5h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	12,766,806 - 12,804,611 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	12,766,734 - 12,791,590 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Supt5h
185 total Variants

Assembly: mRatBN7.2

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
1	83591271	83591272	C	A	snv	BXH2/CubMcwi (2020), WKY/NCrl (2019NG), HXB10/IpcvMcwi (2019), HXB2/IpcvMcwi (2019), HXB4/IpcvMcwi (2020), SHR/OlalpcvMcwi (2019), WKY/NCrl (2019), WKY/N (2020), BXH6/CubMcwi (2021), European Variation Archive Release 3, European Variation Archive Release 4, European Variation Archive Release 6, HXB23/IpcvMcwi (2021), SHR/NCrl (2021), SHR/NHsd (2021), SHR/NHsd (2021), SHR/OlalpcvMcwi (2019NG), BXH3/CubMcwi (2020)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	91
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000048905, ENSRNOT00000057470
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

RH124224

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	83,590,293 - 83,590,488 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	85,463,079 - 85,463,273	NCBI	Rnor6.0
Rnor_5.0	1	86,676,682 - 86,676,876	UniSTS	Rnor5.0
RGSC_v3.4	1	83,408,363 - 83,408,557	UniSTS	RGSC3.4
Celera	1	77,989,111 - 77,989,305	UniSTS
Cytogenetic Map	1	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB751273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR755056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ764483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY319730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L41685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000048905 ⟹ ENSRNOP00000049521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,438,105 - 85,466,635 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,460,888 - 85,466,854 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093383

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,437,816 - 85,460,238 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093384 ⟹ ENSRNOP00000076183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,460,888 - 85,466,854 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093740 ⟹ ENSRNOP00000076244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,586,718 - 83,616,892 (-)	Ensembl
Rnor_6.0 Ensembl	1	85,437,780 - 85,460,238 (+)	Ensembl

RefSeq Acc Id:

NM_001107497 ⟹ NP_001100967

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,445 (-)	NCBI
mRatBN7.2	1	83,586,713 - 83,616,892 (-)	NCBI
Rnor_6.0	1	85,437,780 - 85,466,854 (+)	NCBI
Rnor_5.0	1	86,651,790 - 86,680,457 (+)	NCBI
RGSC_v3.4	1	83,433,056 - 83,434,029 (-)	RGD
Celera	1	77,985,530 - 78,013,882 (-)	NCBI

Sequence:

show sequence

CGAGAGAGCGCTCAGGCCAGCTAGGCGTTGTGTGATCAGCAGCTGGCGCGGAAGCTTCAGGTGGACAGTGATCGTTGCGGAAGATGTCGGACAGCGAAGACAGCAACTTCTCGGAGGAGGAGGACAGC
GAGCGCAGCAGCGAGGCGGAGGAGGCCGAGGTAGAGGAAGACCGGCGAAGTGCCGCAGGCAGTGAAAAAGAAGAGGAGCCCGAGGAAGAGGAGGAGGAGGAAGAGGAGGAATACGATGAGGAGGAGGA
GGAGGAGGATGATGACCGGCCTCCCAAGAAACCACGCCATGGGGGCTTCATTTTAGATGAGGCTGATGTCGATGATGAATATGAAGATGAAGACCAGTGGGAAGATGGAGCTGAAGATATCCTGGAGA
AAGAAGAGATTGAAGCCTCCAACATTGATAACGTTGTGCTGGATGAAGACCGCTCTGGGGCTCGTCGTCTGCAAAATCTCTGGAGGGACCAGAGAGAAGAAGAACTGGGCGAGTATTACATGAAGAAA
TATGCCAAGTCATCTGTGGGAGAGACGGTATATGGAGGGTCTGATGAGCTCTCAGATGACATCACCCAGCAGCAGCTGCTCCCAGGAGTCAAGGACCCCAACCTGTGGACGGTCAAGTGTAAGATTGG
GGAGGAACGGGCCACAGCAATTTCCTTGATGCGAAAATTCATCGCTTACCAGTTCACAGACACACCCCTGCAGATTAAGTCAGTGGTTGCCCCGGAGCATGTGAAGGGCTACATCTATGTGGAGGCCT
ACAAACAGACCCATGTGAAGCAGGCCATTGAGGGTGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCTATTAAGGAGATGACCGATGTACTCAAGGTGGTGAAGGAGGTGGCCAAC
CTGAAGCCGAAGTCCTGGGTCCGCCTCAAGAGAGGCATCTACAAAGATGACATCGCTCAGGTGGACTACGTCGAGCCCAGCCAGAACACCATTTCCCTGAAGATGATCCCGCGCATTGACTATGACCG
CATCAAAGCCCGCATGAGCTTGAAAGACTGGTTTGCCAAAAGGAAGAAGTTCAAGCGGCCTCCACAGAGGCTCTTTGATGCTGAAAAGATCAGGTCCTTGGGGGGTGATGTTGCCTCTGATGGTGACT
TCCTCATCTTTGAGGGTAACCGCTACAGCCGGAAGGGCTTCCTGTTCAAGAGTTTTGCCATGTCTGCTGTGATTACAGAAGGTGTAAAGCCCACCCTGTCAGAGCTGGAAAAGTTTGAGGATCAGCCT
GAGGGCATCGACTTGGAGGTGGTGACTGAAAGCACAGGGAAGGAGCGAGAGCACAATTTCCAGCCTGGTGACAATGTGGAGGTGTGTGAGGGTGAGCTCATCAACCTGCAGGGCAAGGTCCTCAGCGT
GGATGGCAACAAGATCACCATCATGCCCAAACATGAGGACCTCAAGGACATGCTTGAGTTCCCAGCTCAGGAACTTCGGAAGTACTTCAAGATGGGAGACCATGTAAAAGTGATTGCTGGCCGATTTG
AGGGTGACACAGGTCTCATCGTGCGGGTGGAAGAGAACTTTGTTATTCTTTTCTCAGACCTCACCATGCACGAGTTGAAAGTGCTTCCCCGGGATCTGCAGCTCTGCTCAGAGACAGCCTCAGGTGTG
GATGTTGGGGGCCAGCATGAGTGGGGTGAGCTGGTGCAGTTGGATCCCCGGACTGTAGGTGTCATCGTGCGGCTGGAGCGAGAGACCTTCCAGGTTCTCAACATGCATGGGAAAGTGGTGACTGTAAG
GCACCAGGCTGTGACGCAGAAAAAGGACAACCGCTTCGCTGTGGCTCTGGACTCAGATCAGAACAACATCCATGTGAAGGACATTGTTAAGGTCATTGATGGCCCCCATTCAGGCCGAGAGGGTGAGA
TCCGCCATCTGTACCGCAGCTTTGCCTTCCTGCATTGCAAGAAGCTGGTGGAGAATGGCGGCATGTTTGTCTGTAAGGCACGGCACCTGGTGTTGGCTGGGGGCTCAAAGCCCCGGGATGTGACCAAT
TTAACTGTTGGTGGCTTCACTCCTATGAGCCCCCGGATCAGCAGCCCTATGCACCCCAGTGCTGAAGGTCAGCATGGTGGTTTTGGAAGCCCAGGTGGCATGAGCAGGGGTCGAGGGCGAAGAGACAA
TGAGCTCATAGGCCAGACTGTGCGTATCTCCCAGGGACCCTACAAAGGCTACATTGGTGTGGTGAAGGATGCCACGGAGTCCACAGCCCGAGTAGAATTGCACTCTACCTGCCAGACCATCTCTGTGG
ACCGCCAGCGGCTCACCACAGTTGACTCCCAGCGTCCAGGTGGCATGACTTCCACCTATGGAAGGACTCCCATGTATGGCTCTCAGACTCCCATGTATGGCTCTGGCTCCCGAACACCCATGTATGGC
TCCCAGACACCTCTGCAGGATGGTAGCCGCACTCCACATTATGGCTCACAGACACCCCTGCATGATGGTAGCCGCACTCCTGCTCAGAGTGGGGCCTGGGATCCCAACAACCCTAACACACCTTCCAG
GGCTGAGGAGGAATACGAATATGCCTTTGACGACGAACCCACCCCATCCCCACAAGCATATGGGGGAACCCCGAATCCCCAAACACCCGGCTACCCAGACCCATCATCCCCCCAGGTCAATCCACAGT
ACAACCCGCAGACACCCGGGACGCCAGCCATGTACAACACAGACCAGTTCTCCCCCTACGCTGCCCCCTCCCCACAGGGGTCTTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAAGTGGCACCA
AGTCCAGCGGGCTATCAGAACACCCATTCCCCAGCCAGCTACCACCCAACACCGTCACCCATGGCCTATCAGGCTAGTCCCAGCCCCAGCCCTGTTGGCTACAGTCCAATGACCCCTGGAGCTCCTTC
TCCTGGAGGCTACAATCCCCACACACCAGGCTCAGGCATTGAGCAGAACTCCAGTGACTGGGTGACCACTGATATCCAGGTGAAGGTTCGAGACACCTATCTGGACACACAAATAGTGGGGCAGACAG
GCGTCATCCGCAGTGTCACGGGAGGCATGTGCTCCGTGTACCTGAAAGATAGTGAGAAGGTGGTCAGTATCTCCAGTGAGCATCTGGAGCCCATCACCCCCACCAAGAACAACAAGGTGAAAGTGATT
CTGGGTGAGGACCGAGAGGCTACCGGGGTCCTTCTGAGTATTGATGGTGAGGATGGCATCATCCGAATGGACCTGGAAGACCAGCAGATCAAGATTCTAAACCTCCGCTTCCTAGGGAAGCTCCTGGA
GGCCTGAGGCCCAAGCGTGCGGAGCAAGCAGCCCGCTCTGGCCTTGCTTGGCCTAGGATGGAACCCCGAGTCTGGGGCAAGCCAGGGCAATCACTCTGGATTTCCTTTTCCTCCTCCCCTGGTACTCT
AGGAATCAGAGCAGTCTGAGGAATGTCCTGCCTTCTTTCTGCTGTCCCAGCTTGCCTTTGTGTTCAGGCCTTTCAATAAAGAGAAACTGTTTGAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039111567 ⟹ XP_038967495

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,444 (-)	NCBI
mRatBN7.2	1	83,586,932 - 83,616,960 (-)	NCBI

RefSeq Acc Id:

XM_039111569 ⟹ XP_038967497

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,745,489 (-)	NCBI
mRatBN7.2	1	83,586,932 - 83,616,971 (-)	NCBI

RefSeq Acc Id:

XM_039111570 ⟹ XP_038967498

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,509 (-)	NCBI
mRatBN7.2	1	83,586,713 - 83,616,971 (-)	NCBI

RefSeq Acc Id:

XM_063261507 ⟹ XP_063117577

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,388 (-)	NCBI

RefSeq Acc Id:

XM_063261515 ⟹ XP_063117585

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,427 (-)	NCBI

RefSeq Acc Id:

XM_063261518 ⟹ XP_063117588

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,444 (-)	NCBI

RefSeq Acc Id:

XM_063261526 ⟹ XP_063117596

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,745,489 (-)	NCBI

RefSeq Acc Id:

XM_063261528 ⟹ XP_063117598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	92,714,276 - 92,744,147 (-)	NCBI


Protein RefSeqs	NP_001100967	(Get FASTA)	NCBI Sequence Viewer
	XP_038967495	(Get FASTA)	NCBI Sequence Viewer
	XP_038967497	(Get FASTA)	NCBI Sequence Viewer
	XP_038967498	(Get FASTA)	NCBI Sequence Viewer
	XP_063117577	(Get FASTA)	NCBI Sequence Viewer
	XP_063117585	(Get FASTA)	NCBI Sequence Viewer
	XP_063117588	(Get FASTA)	NCBI Sequence Viewer
	XP_063117596	(Get FASTA)	NCBI Sequence Viewer
	XP_063117598	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB05843	(Get FASTA)	NCBI Sequence Viewer
	EDM07902	(Get FASTA)	NCBI Sequence Viewer
	EDM07903	(Get FASTA)	NCBI Sequence Viewer
	EDM07904	(Get FASTA)	NCBI Sequence Viewer
	EDM07905	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000049521.5
	ENSRNOP00000076183.2
	ENSRNOP00000076244.2
	ENSRNOP00000080314.1
	ENSRNOP00000081111.1

RefSeq Acc Id:

NP_001100967 ⟸ NM_001107497

- UniProtKB:

A0A8I5ZQE4 (UniProtKB/TrEMBL), E9PTB2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDSEDSNFSEEEDSERSSEAEEAEVEEDRRSAAGSEKEEEPEEEEEEEEEEYDEEEEEEDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLW
RDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPI
KEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEG
VKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKVLSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKV
LPRDLQLCSETASGVDVGGQHEWGELVQLDPRTVGVIVRLERETFQVLNMHGKVVTVRHQAVTQKKDNRFAVALDSDQNNIHVKDIVKVIDGPHSGREGEIRHLYRSFAFLHCKKLVENGGMFVCKAR
HLVLAGGSKPRDVTNLTVGGFTPMSPRISSPMHPSAEGQHGGFGSPGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVDSQRPGGMTSTYGRTPMYGS
QTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGS
YQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQIVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEH
LEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIIRMDLEDQQIKILNLRFLGKLLEA

hide sequence

Ensembl Acc Id:

ENSRNOP00000076244 ⟸ ENSRNOT00000093740

Ensembl Acc Id:

ENSRNOP00000076183 ⟸ ENSRNOT00000093384

Ensembl Acc Id:

ENSRNOP00000049521 ⟸ ENSRNOT00000048905

RefSeq Acc Id:	XP_038967498 ⟸ XM_039111570
- Peptide Label:	isoform X3
- UniProtKB:	A0A1W2Q6F0 (UniProtKB/TrEMBL), E9PTB2 (UniProtKB/TrEMBL)

Protein Domains

KOW NusG-like N-terminal Spt5 C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTB2-F1-model_v2	AlphaFold	E9PTB2	1-1083	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Supt5h_1

Description:

SPT5 homolog, DSIF elongation factor subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	85,437,802 - 85,437,862	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60255	BioCyc
Ensembl Genes	ENSRNOG00000032034	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000048905.7	UniProtKB/TrEMBL
	ENSRNOT00000093345.2	UniProtKB/TrEMBL
	ENSRNOT00000093383.2	UniProtKB/TrEMBL
	ENSRNOT00000093384.2	UniProtKB/TrEMBL
	ENSRNOT00000093740.2	UniProtKB/TrEMBL
Gene3D-CATH	2.30.30.30	UniProtKB/TrEMBL
	3.30.70.940	UniProtKB/TrEMBL
InterPro	KOW	UniProtKB/TrEMBL
	KOW_Spt5_1	UniProtKB/TrEMBL
	KOW_Spt5_2	UniProtKB/TrEMBL
	KOW_Spt5_3	UniProtKB/TrEMBL
	KOW_Spt5_4	UniProtKB/TrEMBL
	KOW_Spt5_5	UniProtKB/TrEMBL
	KOW_Spt5_6	UniProtKB/TrEMBL
	NGN_dom_sf	UniProtKB/TrEMBL
	NGN_Euk	UniProtKB/TrEMBL
	Rib_L2_dom2	UniProtKB/TrEMBL
	SPT5	UniProtKB/TrEMBL
	Spt5_C_dom	UniProtKB/TrEMBL
	Spt5_N	UniProtKB/TrEMBL
	TF_Spt5	UniProtKB/TrEMBL
	TF_Spt5_NGN-domain	UniProtKB/TrEMBL
	Transcrpt_antiterm_NusG_N	UniProtKB/TrEMBL
	Translation_prot_SH3-like	UniProtKB/TrEMBL
KEGG Report	rno:308472	UniProtKB/TrEMBL
NCBI Gene	308472	ENTREZGENE
PANTHER	PTHR11125	UniProtKB/TrEMBL
	TRANSCRIPTION ELONGATION FACTOR SPT5	UniProtKB/TrEMBL
Pfam	KOW	UniProtKB/TrEMBL
	Spt5-NGN	UniProtKB/TrEMBL
	Spt5_N	UniProtKB/TrEMBL
PhenoGen	Supt5h	PhenoGen
PIRSF	Spt5	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032034	RatGTEx
SMART	CTD	UniProtKB/TrEMBL
	KOW	UniProtKB/TrEMBL
	NGN	UniProtKB/TrEMBL
Superfamily-SCOP	Transl_SH3_like	UniProtKB/TrEMBL
UniProt	A0A1W2Q689	ENTREZGENE, UniProtKB/TrEMBL
	A0A1W2Q6F0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZQE4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZR84_RAT	UniProtKB/TrEMBL
	A6J9H9	ENTREZGENE, UniProtKB/TrEMBL
	A6J9I0_RAT	UniProtKB/TrEMBL
	A6J9I2_RAT	UniProtKB/TrEMBL
	E9PTB2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-07	Supt5h	SPT5 homolog, DSIF elongation factor subunit	Supt5h	suppressor of Ty 5 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Supt5h	suppressor of Ty 5 homolog (S. cerevisiae)			Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	Supt5h	suppressor of Ty 5 homolog (S. cerevisiae)			Symbol and Name status set to provisional	70820	PROVISIONAL