Predicted to enable endopeptidase activator activity and protein-macromolecule adaptor activity. Involved in locomotory behavior. Predicted to be located in membrane and transport vesicle. Predicted to be part of gamma-secretase complex. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in coronary artery disease. Orthologous to human APH1B (aph-1 homolog B, gamma-secretase subunit); PARTICIPATES IN Notch signaling pathway; syndecan signaling pathway; Alzheimer's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one.
[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of APH1B more ...
[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APH1B mRNA
[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of APH1B more ...
[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of APH1B more ...
[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of APH1B mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of APH1B mRNA
[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of APH1B mRNA and [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of APH1B mRNA
[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APH1B mRNA
MTAPVFFGCAFIAFGPALALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRD GPVQNYLLIFGVLLSVCIQELFRLAYYRLLKKASEGLKSINPEETAPSMRLLAYVSGLGFGIMS GVFSFVNTLSNALGPGTVGIHGDSPQFFLNSAFMTLVIIMLHVFWGIVFFDGCEKNKWYILLTV LLTHLLVSTQTLLSPHYEVNLVTAYIIMVLMGIWAFCVAGGSRRSLKLCLLCQDKDFLLYNQRS R