Advanced Search (OLGA)

Gene: Camp (cathelicidin antimicrobial peptide) Rattus norvegicus

Analyze

Symbol:

Camp

Name:

cathelicidin antimicrobial peptide

RGD ID:

1559878

Description:

Predicted to enable lipopolysaccharide binding activity. Involved in several processes, including cellular response to cytokine stimulus; positive regulation of cytokine production; and response to bacterium. Located in cell projection and extracellular space. Biomarker of dentin caries and pancreatitis. Orthologous to human CAMP (cathelicidin antimicrobial peptide); PARTICIPATES IN tuberculosis pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cathelicidin; cathelin-related antimicrobial peptide; CRAMP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	118,720,184 - 118,721,998 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	118,720,184 - 118,721,998 (-)	Ensembl				GRCr8
mRatBN7.2	8	109,841,729 - 109,843,543 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,841,729 - 109,843,543 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	115,457,212 - 115,459,026 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,656,393 - 113,658,207 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	111,499,195 - 111,501,009 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	117,930,557 - 117,932,371 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,930,546 - 117,932,518 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	117,283,070 - 117,284,884 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	114,214,914 - 114,216,728 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	109,131,521 - 109,133,335 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

dentin caries (IEP)

Erythema (ISO)

Experimental Autoimmune Myocarditis (ISO)

Neonatal Sepsis (ISO)

pancreatitis (IEP)

Pneumococcal Meningitis (IEP)

rosacea (ISO)

Sepsis (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

aluminium oxide (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP)

butanal (ISO)

cadmium dichloride (EXP,ISO)

calcipotriol (ISO)

calcitriol (ISO)

capsaicin (EXP)

carbon nanotube (ISO)

carnosic acid (ISO)

dexamethasone (ISO)

diallyl disulfide (ISO)

Diallyl sulfide (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

diclofenac (ISO)

dioxygen (EXP,ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (EXP)

ethanol (ISO)

genistein (EXP,ISO)

glyoxal (EXP)

isoflurane (ISO)

ivermectin (ISO)

lithocholic acid (ISO)

LY294002 (ISO)

maneb (EXP,ISO)

manganese(II) chloride (EXP)

metacetamol (ISO)

methylmercury chloride (EXP)

mifepristone (ISO)

naphthalene (ISO)

nicotine (ISO)

nitrofen (EXP)

paracetamol (ISO)

paraquat (EXP,ISO)

paricalcitol (ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

progesterone (ISO)

propanal (ISO)

pterostilbene (ISO)

pyridaben (ISO)

resveratrol (ISO)

SB 203580 (ISO)

selenium atom (EXP)

selumetinib (ISO)

senecionine (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

streptozocin (ISO)

T-2 toxin (EXP)

tert-butyl hydroperoxide (EXP)

testosterone (EXP)

tetrachloromethane (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid fibril formation (IEA,ISO)

antibacterial humoral response (IEA)

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,IEA,ISO)

cellular response to butyrate (IEP)

cellular response to exogenous dsRNA (IEP)

cellular response to interleukin-1 (IEP)

cellular response to interleukin-6 (IEP)

cellular response to lipopolysaccharide (IEP)

cellular response to peptidoglycan (IEP)

cellular response to tumor necrosis factor (IEP)

chronic inflammatory response (ISO)

cytolysis (ISO)

defense response (IEA)

defense response to bacterium (IEA,ISO)

defense response to Gram-negative bacterium (IBA,IMP,ISO)

defense response to Gram-positive bacterium (IBA,IDA,IEA,IMP,ISO)

dentinogenesis (IEP)

innate immune response (IBA,IEA,ISO)

innate immune response in mucosa (IEA,ISO)

killing by host of symbiont cells (IEA,ISO)

leukotriene biosynthetic process (IDA)

negative regulation of apoptotic process (IDA)

neutrophil activation (IEA,ISO)

positive regulation of angiogenesis (IMP)

positive regulation of antimicrobial humoral response (IMP)

positive regulation of cell population proliferation (IDA,IMP)

positive regulation of granulocyte macrophage colony-stimulating factor production (IDA)

positive regulation of insulin secretion involved in cellular response to glucose stimulus (IDA)

positive regulation of interleukin-1 beta production (IDA)

positive regulation of interleukin-8 production (ISO)

positive regulation of macrophage inflammatory protein 1 alpha production (IDA)

positive regulation of monocyte chemotactic protein-1 production (IDA)

positive regulation of protein phosphorylation (IMP)

positive regulation of tumor necrosis factor production (IDA)

prostaglandin production involved in inflammatory response (IDA)

response to glucose (IEP)

Cellular Component

cell projection (IDA)

extracellular region (IEA)

extracellular space (IBA,IDA,IEA,ISO)

specific granule (IEA,ISO)

Molecular Function

lipopolysaccharide binding (IBA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression and regulation of antimicrobial peptide rCRAMP after bacterial infection in primary rat meningeal cells.	Brandenburg LO, etal., J Neuroimmunol. 2009 Dec 10;217(1-2):55-64. Epub 2009 Oct 30.
2.	Lysozyme-modified probiotic components protect rats against polymicrobial sepsis: role of macrophages and cathelicidin-related innate immunity.	Bu HF, etal., J Immunol. 2006 Dec 15;177(12):8767-76.
3.	Cathelicidin rCRAMP stimulates rat mast cells to generate cysteinyl leukotrienes, synthesize TNF and migrate: involvement of PLC/A2, PI3K and MAPK signaling pathways.	Bąbolewska E, etal., Int Immunol. 2014 Nov;26(11):637-46. doi: 10.1093/intimm/dxu069. Epub 2014 Jul 2.
4.	Effect of antibacterial cathelicidin peptide CAP18/LL-37 on sepsis in neonatal rats.	Fukumoto K, etal., Pediatr Surg Int. 2005 Jan;21(1):20-4. doi: 10.1007/s00383-004-1256-x.
5.	Capsular antigen fraction 1 and Pla modulate the susceptibility of Yersinia pestis to pulmonary antimicrobial peptides such as cathelicidin.	Galván EM, etal., Infect Immun. 2008 Apr;76(4):1456-64. doi: 10.1128/IAI.01197-07. Epub 2008 Jan 28.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Expression and localization of CRAMP in rat tooth germ and during reparative dentin formation.	Horibe K, etal., Clin Oral Investig. 2018 Sep;22(7):2559-2566. doi: 10.1007/s00784-018-2353-x. Epub 2018 Feb 2.
8.	Cathelicidin antimicrobial peptide inhibits fibroblast migration via P2X7 receptor signaling.	Kumagai S, etal., Biochem Biophys Res Commun. 2013 Aug 9;437(4):609-14. doi: 10.1016/j.bbrc.2013.07.010. Epub 2013 Jul 15.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Cathelicidin Antimicrobial Peptide: A Novel Regulator of Islet Function, Islet Regeneration, and Selected Gut Bacteria.	Pound LD, etal., Diabetes. 2015 Dec;64(12):4135-47. doi: 10.2337/db15-0788. Epub 2015 Sep 14.
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Cathelicidins positively regulate pancreatic β-cell functions.	Sun J, etal., FASEB J. 2016 Feb;30(2):884-94. doi: 10.1096/fj.15-275826. Epub 2015 Nov 2.
16.	Bactericidal activity of mammalian cathelicidin-derived peptides.	Travis SM, etal., Infect Immun. 2000 May;68(5):2748-55. doi: 10.1128/IAI.68.5.2748-2755.2000.
17.	The cationic host defense peptide rCRAMP promotes gastric ulcer healing in rats.	Yang YH, etal., J Pharmacol Exp Ther. 2006 Aug;318(2):547-54. Epub 2006 May 2.

Additional References at PubMed

PMID:7529412	PMID:9148921	PMID:9182550	PMID:12759353	PMID:12860195	PMID:14978112	PMID:15934934	PMID:16020269	PMID:16177355	PMID:17012259	PMID:18714013	PMID:19056867
PMID:20209079	PMID:20392497	PMID:20421939	PMID:21115716	PMID:23376485	PMID:23533145	PMID:23537644	PMID:23670560

Genomics

Comparative Map Data

Camp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	118,720,184 - 118,721,998 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	118,720,184 - 118,721,998 (-)	Ensembl				GRCr8
mRatBN7.2	8	109,841,729 - 109,843,543 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,841,729 - 109,843,543 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	115,457,212 - 115,459,026 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,656,393 - 113,658,207 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	111,499,195 - 111,501,009 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	117,930,557 - 117,932,371 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,930,546 - 117,932,518 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	117,283,070 - 117,284,884 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	114,214,914 - 114,216,728 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	109,131,521 - 109,133,335 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

CAMP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	48,223,495 - 48,225,485 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	48,223,347 - 48,225,491 (+)	Ensembl			hg38	GRCh38
GRCh37	3	48,264,985 - 48,266,975 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	48,239,866 - 48,241,979 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	48,239,865 - 48,241,979	NCBI
Celera	3	48,215,428 - 48,217,541 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	48,318,971 - 48,321,115 (+)	NCBI		HuRef
CHM1_1	3	48,217,141 - 48,219,285 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	48,251,295 - 48,253,285 (+)	NCBI		T2T-CHM13v2.0

Camp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	109,676,445 - 109,678,524 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	109,676,447 - 109,678,685 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	109,847,377 - 109,849,456 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	109,847,379 - 109,849,617 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	109,749,891 - 109,751,970 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	109,704,793 - 109,706,855 (-)	NCBI		MGSCv36	mm8
Celera	9	109,574,006 - 109,576,084 (-)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI
cM Map	9	59.8	NCBI

Camp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955420	24,911,920 - 24,914,698 (+)	NCBI	ChiLan1.0	ChiLan1.0

CAMP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	48,190,780 - 48,192,806 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	48,195,548 - 48,197,574 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	48,137,785 - 48,139,893 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	49,222,110 - 49,224,250 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	49,222,110 - 49,224,250 (+)	Ensembl			panPan2	panpan1.1

CAMP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	40,790,823 - 40,792,781 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	40,790,811 - 40,792,794 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	40,708,394 - 40,710,352 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	41,276,545 - 41,278,503 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	41,276,545 - 41,278,516 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	40,517,066 - 40,519,024 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	40,918,458 - 40,920,416 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	41,199,059 - 41,201,017 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC110255221
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	31,011,029 - 31,013,164 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CAMP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	9,610,180 - 9,618,629 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	9,610,298 - 9,613,016 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	157,484,000 - 157,493,140 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Camp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	73,429,893 - 73,431,104 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Camp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	100,463,186 - 100,465,024 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Camp
35 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	150
Count of miRNA genes:	118
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000028130
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	7	45	121	72	75	48	85	48	2	270	152	11	102	49	72	27	6	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF484553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028130 ⟹ ENSRNOP00000028130

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	118,720,184 - 118,721,998 (-)	Ensembl
mRatBN7.2 Ensembl	8	109,841,729 - 109,843,543 (-)	Ensembl
Rnor_6.0 Ensembl	8	117,930,546 - 117,932,518 (-)	Ensembl

RefSeq Acc Id:

NM_001100724 ⟹ NP_001094194

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	118,720,184 - 118,721,998 (-)	NCBI
mRatBN7.2	8	109,841,729 - 109,843,543 (-)	NCBI
Rnor_6.0	8	117,930,557 - 117,932,371 (-)	NCBI
Rnor_5.0	8	117,283,070 - 117,284,884 (-)	NCBI
RGSC_v3.4	8	114,214,914 - 114,216,728 (-)	RGD
Celera	8	109,131,521 - 109,133,335 (-)	RGD

Sequence:

show sequence

GAACCATGCAACCCCATAGGGACGTCCCTTCCCTGTGGCGCTCACTGTCACTGCTATTGCTCCT
GGGCCTTGGGTTGCCTCTAGCCGTTTCCCAGACCCTCAGCTACAGGGAGGCTGTACTCCGTGCT
GTGGATGACTTCAACCAGCAGTCTTTGGACACCAATCTCTACCGTCTCCTGGACCTGGATTCTG
AGCCCCAAGGGGATGAGGACCCAGATACTCCCAAGTATGTGAGGTTCCGAGTGAAGGAGACTGT
CTGTAGCAAGGCATCACAGCAGTTACCTGAGCAATGTGCCTTCAAGGAACAGGGGGTAGTGAAG
CAGTGTATGGGGACAGTCACCCTGAACCAGGCTGCAGAGTCTTTTGACATCAGTTGTGATGCGC
CTGGTATACAGCCTTTCCGGTTCAAGAAAATTTCCCGGCTGGCTGGACTCCTCCGAAAAGGTGG
AGAGAAGTTTGGTGAAAAGCTTAGGAAAATCGGCCAGAAAATTAAGGATTTTTTCCAGAAACTT
GCACCTGAAATAGAGCAGTAGGCCTGCCTTGGCCTGTTTTTGGATTCCCAAAATAATAAACTTG
GTAAAAGAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094194	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ05977	(Get FASTA)	NCBI Sequence Viewer
	EDL77100	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028130
	ENSRNOP00000028130.4

RefSeq Acc Id:	NP_001094194 ⟸ NM_001100724
- Peptide Label:	precursor
- UniProtKB:	G3V8S9 (UniProtKB/TrEMBL), A6I3C7 (UniProtKB/TrEMBL), Q71KM5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQPHRDVPSLWRSLSLLLLLGLGLPLAVSQTLSYREAVLRAVDDFNQQSLDTNLYRLLDLDSEP QGDEDPDTPKYVRFRVKETVCSKASQQLPEQCAFKEQGVVKQCMGTVTLNQAAESFDISCDAPG IQPFRFKKISRLAGLLRKGGEKFGEKLRKIGQKIKDFFQKLAPEIEQ hide sequence

Ensembl Acc Id:

ENSRNOP00000028130 ⟸ ENSRNOT00000028130

Protein Domains

Cathelicidin antimicrobial peptide C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8S9-F1-model_v2	AlphaFold	G3V8S9	1-175	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1559878	AgrOrtholog
BioCyc Gene	G2FUF-29085	BioCyc
Ensembl Genes	ENSRNOG00000020733	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028130	ENTREZGENE
	ENSRNOT00000028130.9	UniProtKB/TrEMBL
Gene3D-CATH	3.10.450.10	UniProtKB/TrEMBL
InterPro	Cathelicidin	UniProtKB/TrEMBL
	Cathelicidin_CS	UniProtKB/TrEMBL
	Cathlecidin_C	UniProtKB/TrEMBL
	Cystatin_sf	UniProtKB/TrEMBL
KEGG Report	rno:316010	UniProtKB/TrEMBL
NCBI Gene	316010	ENTREZGENE
PANTHER	CATHELICIDIN ANTIMICROBIAL PEPTIDE	UniProtKB/TrEMBL
	PTHR10206	UniProtKB/TrEMBL
Pfam	CAP18_C	UniProtKB/TrEMBL
	Cathelicidins	UniProtKB/TrEMBL
PharmGKB	CAMP	RGD
PhenoGen	Camp	PhenoGen
PROSITE	CATHELICIDINS_1	UniProtKB/TrEMBL
	CATHELICIDINS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020733	RatGTEx
Superfamily-SCOP	SSF54403	UniProtKB/TrEMBL
UniProt	A6I3C7	ENTREZGENE, UniProtKB/TrEMBL
	G3V8S9	ENTREZGENE, UniProtKB/TrEMBL
	Q71KM5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Camp	cathelicidin antimicrobial peptide	CRAMP	cathelicidin	Symbol and Name updated	1299863	APPROVED
2006-02-09	CRAMP	cathelicidin			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)