Advanced Search (OLGA)

Gene: Slc51a (solute carrier family 51 member A) Rattus norvegicus

Analyze

Symbol:

Slc51a

Name:

solute carrier family 51 member A

RGD ID:

1311100

Description:

Predicted to enable bile acid transmembrane transporter activity; protein heterodimerization activity; and protein homodimerization activity. Predicted to be involved in bile acid and bile salt transport and bile acid secretion. Located in basolateral plasma membrane. Human ortholog(s) of this gene implicated in progressive familial intrahepatic cholestasis. Orthologous to human SLC51A (solute carrier family 51 member A); INTERACTS WITH (-)-epigallocatechin 3-gallate; 17alpha-ethynylestradiol; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC303879; organic solute transporter alpha; organic solute transporter subunit alpha; Osta; Ostalpha; RGD1311100; similar to RIKEN cDNA D630035O19; solute carrier family 51 subunit alpha; solute carrier family 51, alpha subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC51A (solute carrier family 51 member A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc51a (solute carrier family 51, alpha subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc51a (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC51A (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC51A (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc51a (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC51A (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC51A (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc51a (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Slc51a (solute carrier family 51 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BRAP (BRCA1 associated protein)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Slc51a (solute carrier family 51, alpha subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC51A (solute carrier family 51 member A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc51a (solute carrier family 51 alpha subunit)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	osta-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG6836	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG6836	Alliance	DIOPT (OMA\|OrthoFinder)
Caenorhabditis elegans (roundworm):	osta-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	osta-2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	osta-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	osta-3	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	slc51a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	81,804,141 - 81,818,539 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	81,803,972 - 81,818,539 (+)	Ensembl				GRCr8
mRatBN7.2	11	68,299,086 - 68,313,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,299,086 - 68,313,485 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	77,136,126 - 77,150,524 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	69,800,636 - 69,815,078 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	68,825,248 - 68,839,646 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	71,533,078 - 71,547,476 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,533,078 - 71,547,476 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	74,617,803 - 74,632,201 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	70,115,430 - 70,129,828 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	67,731,785 - 67,746,102 (+)	NCBI		Celera
RGSC_v3.1	11	70,173,221 - 70,187,418 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cholestasis (ISO)

cognitive disorder (ISO)

Diabetes Complications (ISO)

primary biliary cholangitis (ISO)

Progressive Familial Intrahepatic Cholestasis 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (EXP,ISO)

(S)-colchicine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

alfacalcidol (ISO)

all-trans-retinoic acid (ISO)

allocholic acid (ISO)

amoxicillin (ISO)

arsane (ISO)

arsenic atom (ISO)

atazanavir sulfate (ISO)

Augmentin (ISO)

Azoxymethane (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-hexachlorocyclohexane (ISO)

bisphenol A (EXP,ISO)

bosentan (ISO)

bromobenzene (EXP)

budesonide (EXP,ISO)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (ISO)

calcitriol (ISO)

captan (ISO)

chenodeoxycholic acid (EXP,ISO)

chlorotoluron (ISO)

cholic acid (ISO)

choline (EXP)

cisplatin (ISO)

clavulanic acid (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

diquat (ISO)

diuron (EXP)

epoxiconazole (ISO)

fenvalerate (EXP)

fidaxomicin (ISO)

fipronil (EXP)

flutamide (EXP)

fluxapyroxad (ISO)

folpet (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

GW 4064 (ISO)

hydrogen peroxide (ISO)

ibuprofen (ISO)

imipenem hydrate (ISO)

L-methionine (EXP)

leflunomide (ISO)

lithocholic acid (EXP,ISO)

loperamide (ISO)

methapyrilene (ISO)

methimazole (EXP)

methotrexate (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

O-methyleugenol (ISO)

obeticholic acid (ISO)

okadaic acid (ISO)

oleanolic acid (ISO)

paracetamol (EXP,ISO)

perfluorobutanesulfonic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl caffeate (ISO)

phenobarbital (EXP,ISO)

procymidone (ISO)

propiconazole (ISO)

prothioconazole (ISO)

Prothioconazole-desthio (ISO)

psoralen (EXP)

pyrazinecarboxamide (EXP)

quercetin (ISO)

quinolin-8-ol (ISO)

resveratrol (ISO)

rifampicin (ISO)

ritonavir (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

sulforaphane (ISO)

Sunset Yellow FCF (ISO)

tamoxifen (ISO)

taurochenodeoxycholic acid (ISO)

taurocholic acid (ISO)

tebuconazole (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid and bile salt transport (IBA,IEA,ISO)

bile acid secretion (IEA,ISO)

transmembrane transport (IEA)

Cellular Component

basolateral plasma membrane (IDA,IEA,ISO)

endoplasmic reticulum membrane (IBA,IEA,ISO)

membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

bile acid transmembrane transporter activity (IEA,ISO)

protein binding (ISO)

protein heterodimerization activity (IEA,ISO)

protein homodimerization activity (IEA,ISO)

transmembrane transporter activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	OSTalpha-OSTbeta: a major basolateral bile acid and steroid transporter in human intestinal, renal, and biliary epithelia.	Ballatori N, etal., Hepatology. 2005 Dec;42(6):1270-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12719432	PMID:17650074	PMID:22535958

Genomics

Comparative Map Data

Slc51a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	81,804,141 - 81,818,539 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	81,803,972 - 81,818,539 (+)	Ensembl				GRCr8
mRatBN7.2	11	68,299,086 - 68,313,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,299,086 - 68,313,485 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	77,136,126 - 77,150,524 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	69,800,636 - 69,815,078 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	68,825,248 - 68,839,646 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	71,533,078 - 71,547,476 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,533,078 - 71,547,476 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	74,617,803 - 74,632,201 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	70,115,430 - 70,129,828 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	67,731,785 - 67,746,102 (+)	NCBI		Celera
RGSC_v3.1	11	70,173,221 - 70,187,418 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

SLC51A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	196,216,534 - 196,233,427 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	196,211,487 - 196,243,178 (+)	Ensembl			hg38	GRCh38
GRCh37	3	195,943,405 - 195,960,298 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	197,427,780 - 197,444,698 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	194,523,852 - 194,541,937 (+)	NCBI		Celera
Cytogenetic Map	3	q29	NCBI
HuRef	3	193,243,225 - 193,260,016 (+)	NCBI		HuRef
CHM1_1	3	195,914,213 - 195,931,131 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	198,936,009 - 198,952,903 (+)	NCBI		T2T-CHM13v2.0

Slc51a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	32,294,396 - 32,306,697 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	32,293,322 - 32,306,697 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	32,475,578 - 32,487,879 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	32,474,504 - 32,487,879 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	32,475,664 - 32,487,965 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	32,395,325 - 32,407,626 (-)	NCBI		MGSCv36	mm8
Celera	16	32,959,481 - 32,971,619 (-)	NCBI		Celera
Cytogenetic Map	16	B3	NCBI
cM Map	16	22.7	NCBI

Slc51a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	12,453,554 - 12,463,150 (+)	Ensembl
ChiLan1.0	NW_004955420	12,452,562 - 12,463,369 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLC51A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	194,078,855 - 194,097,955 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	194,083,598 - 194,102,672 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	193,554,592 - 193,573,984 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	203,504,092 - 203,521,354 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	203,504,092 - 203,521,354 (+)	Ensembl			panPan2	panpan1.1

SLC51A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	29,336,000 - 29,361,782 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	29,336,552 - 29,361,738 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	29,359,044 - 29,386,089 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	29,568,832 - 29,595,224 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	29,577,626 - 29,595,172 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	29,355,369 - 29,382,432 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	29,409,253 - 29,436,254 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	30,032,590 - 30,059,010 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slc51a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	125,000,914 - 125,019,174 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936784	866,350 - 884,355 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936784	864,019 - 887,755 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC51A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	133,851,776 - 133,869,753 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	133,851,775 - 133,869,753 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	143,289,639 - 143,307,618 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC51A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	90,953,601 - 90,970,958 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	90,949,639 - 90,970,240 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	64,791,102 - 64,810,753 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc51a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	61,404,807 - 61,416,384 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	61,405,480 - 61,416,602 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Slc51a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	17,283,983 - 17,297,951 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Slc51a
620 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	140
Count of miRNA genes:	116
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000002405
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	73308487	96070872	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	79618519	99753367	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	73850894	99753367	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	73308315	99753367	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat

Markers in Region

RH131161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	68,313,129 - 68,313,321 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	71,547,121 - 71,547,312	NCBI	Rnor6.0
Rnor_5.0	11	74,631,846 - 74,632,037	UniSTS	Rnor5.0
RGSC_v3.4	11	70,129,473 - 70,129,664	UniSTS	RGSC3.4
Celera	11	67,745,747 - 67,745,938	UniSTS
Cytogenetic Map	11	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	62	69	61	61	30	51	30	5	271	138	3	50	79	82	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002405 ⟹ ENSRNOP00000002405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	81,804,141 - 81,818,539 (+)	Ensembl
mRatBN7.2 Ensembl	11	68,299,086 - 68,313,485 (+)	Ensembl
Rnor_6.0 Ensembl	11	71,533,078 - 71,547,476 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143988 ⟹ ENSRNOP00000104263

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	81,803,972 - 81,818,539 (+)	Ensembl

RefSeq Acc Id:

NM_001107087 ⟹ NP_001100557

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	81,804,141 - 81,818,539 (+)	NCBI
mRatBN7.2	11	68,299,086 - 68,313,485 (+)	NCBI
Rnor_6.0	11	71,533,078 - 71,547,476 (+)	NCBI
Rnor_5.0	11	74,617,803 - 74,632,201 (+)	NCBI
RGSC_v3.4	11	70,115,430 - 70,129,828 (+)	RGD
Celera	11	67,731,785 - 67,746,102 (+)	RGD

Sequence:

show sequence

TAAGGGAGTGTGAAGTCGGAAGGGTTGGGTAGATTGAGAACAAGGTTGCGATCAAAGGCATTTG
TCTGAAAGAGGTGGAAGGAACCACGCCTAAGCCATGGGGAGGAGTTGGGAGATGGCACAGCAGA
GGATCAAATTCCTCTGTGGTGAACTCTGAGATAAAAAGCTGACACTGGAGGCTTAAGGAGGTAA
AGAAAATAGAAGTGGAAGCTCCACTTACTGCTTGGCCCTCACGCAGTGGACAAGAGGCCCTGAG
CACCTCAGAACCGGGCAGAAACCTCCCCACTCCTCAGTGGTTGTCCCTACCTGACCCTCCTCAT
CCTCGGCAGCATCTGCCTGAGAGAAAAGAAGGATGGAGCCAGGCAGGACTCATATAAAACTTGA
CCCCAGGTACACAGCAGATCTTCTGGAGCTGCTGGAAACCAATTACAGCATCTCCCCTGCCTGC
TTCTCTCACCCTCCCACTGCAGCCCAGCTCCTGAGAGAATTGGGCTCAGTGGAAATTGCCCTCA
CCATCATCTTGACCTTTTTTACCATTGGATCAGTTGCCATTTTTCTGGAGGATGCTATTTACCT
ATACAAGAACACCCTTTGCCCCATCAAGAAGAGGACTCTGATCTGGAGTAGCTCTGCGCCCACG
GTGGTGTCTGTGTTCTGCTGCTTTGGTCTCTGGATCCCACGTGCCCTCACACTTGTGGAAATGG
CCATAACCTCGTTTTATGCCGTATGCTTTTACCTGCTGATGATGGTCATGGTGGAAGGCTTTGG
TGGGAAGGAAGCAGTACTAAGGACACTGAAGGACACCCCAATGAGGGTGCACACAGGTCCCTGC
TGCTGCTGCTGTCCCTGCTGCCCACCCCTCATACTTACCAGGAAGAAGCTACAGTTGCTCATGT
TGGGCCCTTTCCAGTATGCCTTCTTCAAGATAGTGATGAGCATAGTGGGCCTGTTTCTCATTCC
TGATGGCATCTATGACCCAGCAGAAATTTCTGAGAAGAGCGCAGCTCTCTGGATCAGCAATTTC
CTTGCTGTGTCCACCCTTTTGGCTCTCTGGTCCCTGGCCATCCTTTTCCGTCAAGCCAAGTTGC
ACCTGGGTGAACAGAATATGGGATCCAAGTTTGCTCTGTTCCAGGTGCTTGTCATCCTGACCGC
CCTGCAGCCCTCCATTTTCTCCATCTTGGCTAACAGCGGGCAGATCGCTTGCTCACCTCCCTAT
TCTTCTAAAATCAGGTCCCAAGTGATGAACTGTCACATGCTCATCCTGGAGACCTTCCTGTTGA
CAGTGCTGACACGCATGTACTATCGAAAGAAAGATAACAAGGTTGGGTATGAGGCTTGTTTACC
GCCAGACCTGGACTCAACGCTCAAAGCCTGACAAGAGCGGCTTGGACTATGGAAGAGTCACTGC
ACTCCTCGGAAGAGCGTGGATTTCCTCTGTCCCTGAGCCTTATCAGTGGTTAAGGCTCCCACTG
ACAGGGCAGGCTGGCAGCCGTCATGGGACTATAGGAATGAGGGTAAAGTGCAGTAGACGGAACC
TGTTTTGAGTCTTTCTCAGGAAAGTTTTGTAATAAATGGTGAAAGCAGAGATGCTTGCACAAAA
TAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100557	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11411	(Get FASTA)	NCBI Sequence Viewer
	EDM11412	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002405
	ENSRNOP00000002405.5
	ENSRNOP00000104263.1

RefSeq Acc Id:

NP_001100557 ⟸ NM_001107087

- UniProtKB:

D4AC81 (UniProtKB/TrEMBL), A6IRQ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPGRTHIKLDPRYTADLLELLETNYSISPACFSHPPTAAQLLRELGSVEIALTIILTFFTIGS
VAIFLEDAIYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAITSFYAVCFY
LLMMVMVEGFGGKEAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLLMLGPFQYAFFKI
VMSIVGLFLIPDGIYDPAEISEKSAALWISNFLAVSTLLALWSLAILFRQAKLHLGEQNMGSKF
ALFQVLVILTALQPSIFSILANSGQIACSPPYSSKIRSQVMNCHMLILETFLLTVLTRMYYRKK
DNKVGYEACLPPDLDSTLKA

hide sequence

Ensembl Acc Id:

ENSRNOP00000002405 ⟸ ENSRNOT00000002405

Ensembl Acc Id:

ENSRNOP00000104263 ⟸ ENSRNOT00000143988

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AC81-F1-model_v2	AlphaFold	D4AC81	1-340	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698209

Promoter ID:

EPDNEW_R8733

Type:

initiation region

Name:

Slc51a_1

Description:

solute carrier family 51, alpha subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	71,533,266 - 71,533,326	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311100	AgrOrtholog
BioCyc Gene	G2FUF-21097	BioCyc
Ensembl Genes	ENSRNOG00000001765	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002405	ENTREZGENE
	ENSRNOT00000002405.7	UniProtKB/TrEMBL
	ENSRNOT00000143988.1	UniProtKB/TrEMBL
InterPro	DUF300	UniProtKB/TrEMBL
KEGG Report	rno:303879	UniProtKB/TrEMBL
NCBI Gene	303879	ENTREZGENE
PANTHER	DUF300	UniProtKB/TrEMBL
Pfam	DUF300	UniProtKB/TrEMBL
PhenoGen	Slc51a	PhenoGen
RatGTEx	ENSRNOG00000001765	RatGTEx
SMART	Solute_trans_a	UniProtKB/TrEMBL
UniProt	A0ABK0L452_RAT	UniProtKB/TrEMBL
	A6IRQ8	ENTREZGENE, UniProtKB/TrEMBL
	D4AC81	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-28	Slc51a	solute carrier family 51 member A	Slc51a	solute carrier family 51 subunit alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2019-12-06	Slc51a	solute carrier family 51 subunit alpha	Slc51a	solute carrier family 51, alpha subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Slc51a	solute carrier family 51, alpha subunit	Ostalpha	organic solute transporter alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Ostalpha	organic solute transporter alpha	Osta	organic solute transporter alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-27	Osta	organic solute transporter alpha	RGD1311100_predicted	similar to RIKEN cDNA D630035O19 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1311100_predicted	similar to RIKEN cDNA D630035O19 (predicted)	LOC303879_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC303879_predicted	similar to RIKEN cDNA D630035O19 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM