Symbol:
Tpr
Name:
translocated promoter region, nuclear basket protein
RGD ID:
1310664
Description:
Predicted to enable several functions, including dynein complex binding activity; mitogen-activated protein kinase binding activity; and protein homodimerization activity. Predicted to be a structural constituent of nuclear pore. Involved in positive regulation of protein export from nucleus and protein export from nucleus. Located in nuclear inclusion body; nuclear membrane; and nuclear periphery. Part of nuclear pore nuclear basket. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder. Orthologous to human TPR (translocated promoter region, nuclear basket protein); PARTICIPATES IN RNA transport pathway; thyroid cancer pathway; INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,2',5,5'-tetrachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC304862; megator; NPC-associated intranuclear protein; nucleoprotein TPR; translocated promoter region; translocated promoter region (to activated MET oncogene)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TPR (translocated promoter region, nuclear basket protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Tpr (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tpr (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TPR (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TPR (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tpr (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TPR (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TPR (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tpr (translocated promoter region, nuclear basket protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HIP1R (huntingtin interacting protein 1 related) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TPR (translocated promoter region, nuclear basket protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tpr (translocated promoter region, nuclear basket protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tpra (translocated promoter region a, nuclear basket protein)
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
tprb (translocated promoter region b, nuclear basket protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MLP1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Mtor
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Mtor
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
npp-21
Alliance
DIOPT (Hieranoid|InParanoid|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
MLP2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tpr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 64,974,419 - 65,037,604 (+) NCBI GRCr8 mRatBN7.2 13 62,424,312 - 62,487,502 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,424,312 - 62,487,496 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,070,740 - 65,133,881 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,341,843 - 66,405,114 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,603,135 - 63,666,355 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,611,685 - 67,672,833 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,611,708 - 67,672,827 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,576,506 - 72,637,654 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 64,688,585 - 64,753,555 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 64,702,435 - 64,767,635 (+) NCBI Celera 13 62,384,785 - 62,447,122 (+) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tpr Rat (+)-catechin multiple interactions ISO TPR (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of TPR mRNA CTD PMID:24763279 Tpr Rat (1->4)-beta-D-glucan multiple interactions ISO Tpr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TPR mRNA CTD PMID:36331819 Tpr Rat (S)-nicotine increases expression ISO TPR (Homo sapiens) 6480464 Nicotine results in increased expression of TPR mRNA CTD PMID:16949557 Tpr Rat 1-chloro-2,4-dinitrobenzene affects binding ISO TPR (Homo sapiens) 6480464 Dinitrochlorobenzene binds to TPR protein CTD PMID:32991956 Tpr Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TPR mRNA CTD PMID:20068009 Tpr Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Tpr Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO TPR (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Tpr Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Tpr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tpr (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TPR mRNA CTD PMID:18691609 and PMID:21570461 Tpr Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TPR mRNA CTD PMID:33387578 Tpr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TPR mRNA CTD PMID:34747641 Tpr Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TPR mRNA CTD PMID:21346803 Tpr Rat 2,6-dimethoxyphenol multiple interactions ISO TPR (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of TPR protein CTD PMID:38598786 Tpr Rat 2-hydroxybenzoic acid (3,3,5-trimethylcyclohexyl) ester increases expression ISO TPR (Homo sapiens) 6480464 homosalate results in increased expression of TPR mRNA CTD PMID:38381479 Tpr Rat 2-hydroxybenzoic acid (3,3,5-trimethylcyclohexyl) ester multiple interactions ISO TPR (Homo sapiens) 6480464 Polystyrenes promotes the reaction [homosalate results in increased expression of TPR mRNA] CTD PMID:38381479 Tpr Rat 2-methylcholine affects expression ISO TPR (Homo sapiens) 6480464 beta-methylcholine affects the expression of TPR mRNA CTD PMID:21179406 Tpr Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO TPR (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of TPR protein CTD PMID:31675489 Tpr Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Tpr (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TPR mRNA CTD PMID:26251327 Tpr Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TPR protein CTD PMID:34915118 Tpr Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TPR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TPR mRNA CTD PMID:28628672 Tpr Rat 4,4'-sulfonyldiphenol multiple interactions ISO TPR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TPR mRNA CTD PMID:28628672 Tpr Rat 4,4'-sulfonyldiphenol affects methylation ISO Tpr (Mus musculus) 6480464 bisphenol S affects the methylation of TPR gene CTD PMID:31683443 Tpr Rat 4,4'-sulfonyldiphenol decreases methylation ISO Tpr (Mus musculus) 6480464 bisphenol S results in decreased methylation of TPR exon CTD PMID:33297965 Tpr Rat 4-hydroxyphenyl retinamide decreases expression ISO Tpr (Mus musculus) 6480464 Fenretinide results in decreased expression of TPR mRNA CTD PMID:28973697 Tpr Rat aflatoxin B1 increases expression ISO Tpr (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of TPR mRNA CTD PMID:19770486 Tpr Rat all-trans-retinoic acid decreases expression ISO TPR (Homo sapiens) 6480464 Tretinoin results in decreased expression of TPR mRNA CTD PMID:15498508 and PMID:21934132 Tpr Rat benzatropine decreases expression ISO TPR (Homo sapiens) 6480464 Benztropine results in decreased expression of TPR protein CTD PMID:34122009 Tpr Rat benzo[a]pyrene increases expression ISO Tpr (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TPR mRNA CTD PMID:21715664 Tpr Rat benzo[a]pyrene diol epoxide I decreases expression ISO TPR (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 and PMID:26238291 Tpr Rat biotin increases expression ISO TPR (Homo sapiens) 6480464 Biotin results in increased expression of TPR mRNA CTD PMID:15219929 Tpr Rat bis(2-ethylhexyl) phthalate decreases expression ISO Tpr (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TPR mRNA CTD PMID:33754040 Tpr Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TPR mRNA CTD PMID:25181051 Tpr Rat bisphenol A decreases expression ISO Tpr (Mus musculus) 6480464 bisphenol A results in decreased expression of TPR mRNA CTD PMID:33221593 Tpr Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TPR mRNA CTD PMID:30816183 Tpr Rat Bisphenol A diglycidyl ether affects splicing ISO Tpr (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of TPR mRNA CTD PMID:36464114 Tpr Rat bisphenol AF affects splicing ISO Tpr (Mus musculus) 6480464 bisphenol AF affects the splicing of TPR mRNA CTD PMID:36464114 Tpr Rat bisphenol AF increases expression ISO TPR (Homo sapiens) 6480464 bisphenol AF results in increased expression of TPR protein CTD PMID:34186270 Tpr Rat Bisphenol B increases expression ISO TPR (Homo sapiens) 6480464 bisphenol B results in increased expression of TPR protein CTD PMID:34186270 Tpr Rat caffeine affects phosphorylation ISO TPR (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TPR protein CTD PMID:35688186 Tpr Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of TPR mRNA CTD PMID:19395590 Tpr Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of TPR mRNA CTD PMID:23125180 Tpr Rat chlorpyrifos decreases expression ISO Tpr (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TPR mRNA CTD PMID:37019170 Tpr Rat clobetasol decreases expression ISO Tpr (Mus musculus) 6480464 Clobetasol results in decreased expression of TPR mRNA CTD PMID:27462272 Tpr Rat clozapine decreases expression ISO TPR (Homo sapiens) 6480464 Clozapine results in decreased expression of TPR protein CTD PMID:34122009 Tpr Rat copper atom multiple interactions ISO TPR (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of TPR mRNA CTD PMID:30911355 Tpr Rat copper(0) multiple interactions ISO TPR (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of TPR mRNA CTD PMID:30911355 Tpr Rat coumarin affects phosphorylation ISO TPR (Homo sapiens) 6480464 coumarin affects the phosphorylation of TPR protein CTD PMID:35688186 Tpr Rat cyclosporin A decreases expression ISO Tpr (Mus musculus) 6480464 Cyclosporine results in decreased expression of TPR mRNA CTD PMID:19770486 Tpr Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of TPR mRNA CTD PMID:30207508 Tpr Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of TPR mRNA CTD PMID:23640034 Tpr Rat dexamethasone multiple interactions ISO TPR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TPR mRNA CTD PMID:28628672 Tpr Rat Dibutyl phosphate affects expression ISO TPR (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TPR mRNA CTD PMID:37042841 Tpr Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of TPR mRNA CTD PMID:25152437 Tpr Rat dorsomorphin multiple interactions ISO TPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tpr Rat doxorubicin decreases expression ISO TPR (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TPR mRNA CTD PMID:29803840 Tpr Rat doxorubicin multiple interactions ISO TPR (Homo sapiens) 6480464 VRK1 protein affects the reaction [Doxorubicin results in increased phosphorylation of TPR protein] CTD PMID:38367682 Tpr Rat doxorubicin decreases phosphorylation ISO TPR (Homo sapiens) 6480464 Doxorubicin results in decreased phosphorylation of TPR protein CTD PMID:38367682 Tpr Rat elemental selenium multiple interactions ISO TPR (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat elemental selenium decreases expression ISO TPR (Homo sapiens) 6480464 Selenium results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat enzyme inhibitor multiple interactions ISO TPR (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TPR protein CTD PMID:23301498 Tpr Rat epoxiconazole decreases expression ISO Tpr (Mus musculus) 6480464 epoxiconazole results in decreased expression of TPR mRNA CTD PMID:35436446 Tpr Rat ethanol affects splicing ISO Tpr (Mus musculus) 6480464 Ethanol affects the splicing of TPR mRNA CTD PMID:30319688 Tpr Rat ferric oxide decreases expression ISO Tpr (Mus musculus) 6480464 ferric oxide analog results in decreased expression of TPR mRNA CTD PMID:24525745 Tpr Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of TPR mRNA CTD PMID:24136188 Tpr Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TPR mRNA CTD PMID:24136188 Tpr Rat folic acid decreases expression ISO Tpr (Mus musculus) 6480464 Folic Acid results in decreased expression of TPR mRNA CTD PMID:25629700 Tpr Rat FR900359 affects phosphorylation ISO TPR (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TPR protein CTD PMID:37730182 Tpr Rat geldanamycin increases expression ISO TPR (Homo sapiens) 6480464 geldanamycin results in increased expression of TPR mRNA CTD PMID:26705709 Tpr Rat genistein decreases expression ISO TPR (Homo sapiens) 6480464 Genistein results in decreased expression of TPR protein CTD PMID:20884965 Tpr Rat genistein multiple interactions ISO TPR (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in decreased expression of TPR protein] CTD PMID:20884965 Tpr Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TPR mRNA CTD PMID:22061828 Tpr Rat hydrogen peroxide increases expression ISO TPR (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of TPR mRNA CTD PMID:18951874 Tpr Rat hydrogen peroxide decreases expression ISO TPR (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of TPR mRNA CTD PMID:34581912 Tpr Rat indometacin multiple interactions ISO TPR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TPR mRNA CTD PMID:28628672 Tpr Rat inulin multiple interactions ISO Tpr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TPR mRNA CTD PMID:36331819 Tpr Rat ivermectin decreases expression ISO TPR (Homo sapiens) 6480464 Ivermectin results in decreased expression of TPR protein CTD PMID:32959892 Tpr Rat malathion increases expression ISO TPR (Homo sapiens) 6480464 Malathion results in increased expression of TPR mRNA CTD PMID:32069766 Tpr Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of TPR mRNA CTD PMID:30467583 Tpr Rat methidathion decreases expression ISO Tpr (Mus musculus) 6480464 methidathion results in decreased expression of TPR mRNA CTD PMID:34813904 Tpr Rat methylmercury chloride increases expression ISO TPR (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TPR mRNA CTD PMID:26272509 Tpr Rat methylmercury chloride decreases expression ISO TPR (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TPR mRNA CTD PMID:28001369 Tpr Rat miconazole decreases expression ISO Tpr (Mus musculus) 6480464 Miconazole results in decreased expression of TPR mRNA CTD PMID:27462272 Tpr Rat nicotine increases expression ISO TPR (Homo sapiens) 6480464 Nicotine results in increased expression of TPR mRNA CTD PMID:16949557 Tpr Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TPR mRNA CTD PMID:25729387 Tpr Rat oxybenzone increases expression ISO TPR (Homo sapiens) 6480464 oxybenzone results in increased expression of TPR mRNA CTD PMID:36581016 Tpr Rat paracetamol affects expression ISO Tpr (Mus musculus) 6480464 Acetaminophen affects the expression of TPR mRNA CTD PMID:17562736 Tpr Rat penconazole increases expression ISO TPR (Homo sapiens) 6480464 penconazole results in increased expression of TPR mRNA CTD PMID:23811263 Tpr Rat pentachlorophenol increases expression ISO Tpr (Mus musculus) 6480464 Pentachlorophenol results in increased expression of TPR mRNA CTD PMID:23892564 Tpr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tpr (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TPR mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TPR mRNA CTD PMID:36331819 Tpr Rat phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of TPR mRNA CTD PMID:17616710 Tpr Rat phenobarbital multiple interactions ISO Tpr (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TPR mRNA] CTD PMID:19482888 Tpr Rat phenobarbital decreases expression ISO Tpr (Mus musculus) 6480464 Phenobarbital results in decreased expression of TPR mRNA CTD PMID:23091169 Tpr Rat phenobarbital increases expression ISO Tpr (Mus musculus) 6480464 Phenobarbital results in increased expression of TPR mRNA CTD PMID:19482888 Tpr Rat phenylmercury acetate decreases expression ISO TPR (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of TPR mRNA CTD PMID:26272509 Tpr Rat phenylmercury acetate multiple interactions ISO TPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TPR mRNA CTD PMID:27188386 Tpr Rat phosphorus atom increases expression ISO TPR (Homo sapiens) 6480464 Phosphorus results in increased expression of TPR mRNA CTD PMID:17715259 Tpr Rat phosphorus(.) increases expression ISO TPR (Homo sapiens) 6480464 Phosphorus results in increased expression of TPR mRNA CTD PMID:17715259 Tpr Rat pirinixic acid decreases expression ISO Tpr (Mus musculus) 6480464 pirinixic acid results in decreased expression of TPR mRNA CTD PMID:17426115 Tpr Rat poly(propylene imine) macromolecule increases expression ISO TPR (Homo sapiens) 6480464 poly(propyleneimine) analog results in increased expression of TPR mRNA CTD PMID:16308212 Tpr Rat pyrimidifen decreases expression ISO TPR (Homo sapiens) 6480464 pyrimidifen results in decreased expression of TPR mRNA CTD PMID:33512557 Tpr Rat quercetin decreases phosphorylation ISO TPR (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of TPR protein CTD PMID:35688186 Tpr Rat resveratrol decreases expression ISO Tpr (Mus musculus) 6480464 resveratrol results in decreased expression of TPR protein CTD PMID:25505154 Tpr Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of TPR mRNA CTD PMID:25905778 Tpr Rat rotenone decreases expression ISO TPR (Homo sapiens) 6480464 Rotenone results in decreased expression of TPR mRNA CTD PMID:33512557 Tpr Rat SB 431542 multiple interactions ISO TPR (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tpr Rat selenium atom multiple interactions ISO TPR (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat selenium atom decreases expression ISO TPR (Homo sapiens) 6480464 Selenium results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat sodium arsenite decreases expression ISO TPR (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TPR mRNA CTD PMID:12679051 Tpr Rat sodium chloride multiple interactions ISO TPR (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of TPR protein CTD PMID:38598786 Tpr Rat T-2 toxin decreases expression ISO TPR (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of TPR mRNA CTD PMID:34581912 Tpr Rat tamibarotene decreases expression ISO TPR (Homo sapiens) 6480464 tamibarotene results in decreased expression of TPR mRNA CTD PMID:15498508 Tpr Rat testosterone enanthate affects expression ISO TPR (Homo sapiens) 6480464 testosterone enanthate affects the expression of TPR mRNA CTD PMID:17440010 Tpr Rat tetrachloromethane increases expression ISO Tpr (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TPR mRNA CTD PMID:27339419 and PMID:31919559 Tpr Rat tetraphene decreases expression ISO Tpr (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of TPR mRNA CTD PMID:26377693 Tpr Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of TPR protein CTD PMID:35544339 Tpr Rat thimerosal decreases expression ISO TPR (Homo sapiens) 6480464 Thimerosal results in decreased expression of TPR mRNA CTD PMID:27188386 Tpr Rat titanium dioxide decreases expression ISO Tpr (Mus musculus) 6480464 titanium dioxide results in decreased expression of TPR mRNA CTD PMID:29264374 Tpr Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of TPR mRNA CTD PMID:22166486 Tpr Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TPR mRNA CTD PMID:25729387 Tpr Rat torcetrapib increases expression ISO TPR (Homo sapiens) 6480464 torcetrapib results in increased expression of TPR mRNA CTD PMID:23228038 Tpr Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TPR mRNA CTD PMID:33387578 Tpr Rat trichostatin A decreases expression ISO TPR (Homo sapiens) 6480464 trichostatin A results in decreased expression of TPR mRNA CTD PMID:24935251 and PMID:26272509 Tpr Rat trichostatin A multiple interactions ISO TPR (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TPR mRNA CTD PMID:27188386 Tpr Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of TPR mRNA CTD PMID:30589522 Tpr Rat triphenyl phosphate affects expression ISO TPR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TPR mRNA CTD PMID:37042841 Tpr Rat troglitazone decreases expression ISO Tpr (Mus musculus) 6480464 troglitazone results in decreased expression of TPR mRNA CTD PMID:28973697 Tpr Rat tungsten decreases expression ISO Tpr (Mus musculus) 6480464 Tungsten results in decreased expression of TPR mRNA CTD PMID:30912803 Tpr Rat valproic acid decreases expression ISO TPR (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TPR mRNA CTD PMID:23179753 and PMID:24935251 Tpr Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of TPR mRNA CTD PMID:29427782 Tpr Rat valproic acid decreases methylation ISO TPR (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TPR gene CTD PMID:29154799 Tpr Rat vitamin E multiple interactions ISO TPR (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat vitamin E decreases expression ISO TPR (Homo sapiens) 6480464 Vitamin E results in decreased expression of TPR mRNA CTD PMID:19244175 Tpr Rat vorinostat decreases expression ISO TPR (Homo sapiens) 6480464 vorinostat results in decreased expression of TPR mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-hydroxybenzoic acid (3,3,5-trimethylcyclohexyl) ester (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) biotin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) Bisphenol B (ISO) caffeine (ISO) carbonyl sulfide (EXP) chloroprene (EXP) chlorpyrifos (ISO) clobetasol (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) cyclosporin A (ISO) DDT (EXP) decabromodiphenyl ether (EXP) dexamethasone (ISO) Dibutyl phosphate (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) ferric oxide (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) geldanamycin (ISO) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) inulin (ISO) ivermectin (ISO) malathion (ISO) methapyrilene (EXP) methidathion (ISO) methylmercury chloride (ISO) miconazole (ISO) nicotine (ISO) oxaliplatin (EXP) oxybenzone (ISO) paracetamol (ISO) penconazole (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) pirinixic acid (ISO) poly(propylene imine) macromolecule (ISO) pyrimidifen (ISO) quercetin (ISO) resveratrol (EXP,ISO) rotenone (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) T-2 toxin (ISO) tamibarotene (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) tetraphene (ISO) thapsigargin (EXP) thimerosal (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) torcetrapib (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) troglitazone (ISO) tungsten (ISO) valproic acid (EXP,ISO) vitamin E (ISO) vorinostat (ISO)
Biological Process
cell division (IEA) cellular response to heat (IEA,ISO,ISS) cellular response to interferon-alpha (ISO,ISS) mitotic spindle assembly checkpoint signaling (IEA,ISO,ISS) mRNA export from nucleus (IBA) mRNA export from nucleus in response to heat stress (IEA,ISO,ISS) mRNA transport (IEA) negative regulation of RNA export from nucleus (IEA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) negative regulation of translational initiation (IEA,ISO,ISS) nuclear matrix organization (ISO,ISS) nuclear pore complex assembly (IMP,ISO) nuclear pore organization (IEA,ISO,ISS) positive regulation of heterochromatin formation (IEA,ISO,ISS) positive regulation of intracellular protein transport (IEA,ISO,ISS) positive regulation of mitotic cell cycle spindle assembly checkpoint (IEA,ISO,ISS) positive regulation of protein export from nucleus (IMP) positive regulation of protein import into nucleus (IEA,ISO,ISS) protein export from nucleus (IMP,ISO,ISS) protein import into nucleus (IEA,ISO,ISS) protein transport (IEA) regulation of mitotic sister chromatid separation (IEA,ISO,ISS) regulation of mitotic spindle assembly (IBA,IEA,ISO,ISS) regulation of mRNA export from nucleus (ISO) regulation of protein export from nucleus (ISO) regulation of protein import into nucleus (IMP,ISO) regulation of protein localization (IEA,ISO) regulation of protein stability (ISO,ISS) response to epidermal growth factor (IEA,ISO,ISS) RNA export from nucleus (IEA,ISO,ISS) RNA import into nucleus (IEA,ISO,ISS)
Cellular Component
chromosome (IEA) chromosome, centromeric region (IEA) cytoplasm (IEA,ISO,ISS) cytoplasmic dynein complex (IEA,ISO,ISS) cytoskeleton (IEA) kinetochore (IEA,ISO,ISS) membrane (IEA) mitotic spindle (IEA,ISO,ISS) nuclear envelope (IEA,ISO,ISS) nuclear inclusion body (IDA,IEA,ISO) nuclear membrane (IDA,IEA,ISO) nuclear periphery (IDA,IEA,ISO) nuclear pore (IBA,IEA,ISO,ISS) nuclear pore nuclear basket (IDA,IEA,ISO) nucleus (IEA,ISO) spindle (IEA)
Molecular Function
chromatin binding (IEA,ISO,ISS) dynein complex binding (IEA,ISO) heat shock protein binding (IEA,ISO,ISS) mitogen-activated protein kinase binding (IEA,ISO,ISS) mRNA binding (IEA,ISO,ISS) protein binding (ISO) protein homodimerization activity (IEA,ISO,ISS) protein-membrane adaptor activity (ISO,ISS) structural constituent of nuclear pore (IBA,IEA,ISO,ISS) tubulin binding (IEA,ISO)
Tpr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 64,974,419 - 65,037,604 (+) NCBI GRCr8 mRatBN7.2 13 62,424,312 - 62,487,502 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 62,424,312 - 62,487,496 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 65,070,740 - 65,133,881 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 66,341,843 - 66,405,114 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 63,603,135 - 63,666,355 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 67,611,685 - 67,672,833 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 67,611,708 - 67,672,827 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 72,576,506 - 72,637,654 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 64,688,585 - 64,753,555 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 64,702,435 - 64,767,635 (+) NCBI Celera 13 62,384,785 - 62,447,122 (+) NCBI Celera Cytogenetic Map 13 q21 NCBI
TPR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 186,311,652 - 186,375,253 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 186,311,652 - 186,375,693 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 186,280,784 - 186,344,385 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 184,547,407 - 184,611,080 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 183,014,615 - 183,076,114 NCBI Celera 1 159,391,490 - 159,455,165 (-) NCBI Celera Cytogenetic Map 1 q31.1 NCBI HuRef 1 157,515,355 - 157,578,976 (-) NCBI HuRef CHM1_1 1 187,702,490 - 187,766,196 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 185,666,310 - 185,729,984 (-) NCBI T2T-CHM13v2.0
Tpr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 150,268,544 - 150,325,686 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 150,268,589 - 150,325,686 (+) Ensembl GRCm39 Ensembl GRCm38 1 150,392,802 - 150,449,935 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 150,392,838 - 150,449,935 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 152,239,968 - 152,297,065 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 152,155,071 - 152,212,147 (+) NCBI MGSCv36 mm8 Celera 1 152,832,018 - 152,889,087 (+) NCBI Celera Cytogenetic Map 1 G1 NCBI cM Map 1 63.84 NCBI
Tpr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 24,742,525 - 24,805,989 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 24,742,525 - 24,805,989 (-) NCBI ChiLan1.0 ChiLan1.0
TPR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 63,343,613 - 63,405,202 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 63,025,048 - 63,086,633 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 161,842,037 - 161,903,567 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 165,993,726 - 166,055,223 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 165,993,726 - 166,055,223 (-) Ensembl panpan1.1 panPan2
TPR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 19,376,951 - 19,442,368 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 19,376,975 - 19,442,303 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 18,898,638 - 18,964,055 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 19,112,960 - 19,178,509 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 19,112,979 - 19,179,044 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 19,019,776 - 19,085,277 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 19,129,102 - 19,194,530 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 19,259,646 - 19,325,389 (-) NCBI UU_Cfam_GSD_1.0
Tpr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 86,203,944 - 86,264,933 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 4,050,794 - 4,111,682 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 4,050,693 - 4,111,682 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TPR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 127,481,684 - 127,540,398 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 127,481,678 - 127,540,393 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 139,933,094 - 139,992,501 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TPR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 43,056,605 - 43,120,570 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 43,056,886 - 43,123,474 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 44,245,730 - 44,312,643 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tpr
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
13
62460855
62460856
G
C
snv
ACI/N (2020) View more Information
Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 14 Count of miRNA genes: 12 Interacting mature miRNAs: 14 Transcripts: ENSRNOT00000063833 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
RH144043
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 62,476,622 - 62,476,792 (+) MAPPER mRatBN7.2 Rnor_6.0 13 67,661,954 - 67,662,123 NCBI Rnor6.0 Rnor_5.0 13 72,626,775 - 72,626,944 UniSTS Rnor5.0 RGSC_v3.4 13 64,742,682 - 64,742,851 UniSTS RGSC3.4 Celera 13 62,436,248 - 62,436,417 UniSTS Cytogenetic Map 13 q21 UniSTS
RH133437
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 65,036,861 - 65,037,503 (+) Marker Load Pipeline mRatBN7.2 13 62,486,755 - 62,487,397 (+) MAPPER mRatBN7.2 Rnor_6.0 13 67,672,087 - 67,672,728 NCBI Rnor6.0 Rnor_5.0 13 72,636,908 - 72,637,549 UniSTS Rnor5.0 RGSC_v3.4 13 64,752,815 - 64,753,456 UniSTS RGSC3.4 Celera 13 62,446,382 - 62,447,023 UniSTS RH 3.4 Map 13 288.0 UniSTS Cytogenetic Map 13 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000063833 ⟹ ENSRNOP00000062172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,424,312 - 62,487,496 (+) Ensembl Rnor_6.0 Ensembl 13 67,611,708 - 67,672,827 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097761 ⟹ ENSRNOP00000094758
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 62,424,312 - 62,487,496 (+) Ensembl
RefSeq Acc Id:
NM_001107185 ⟹ NP_001100655
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 64,974,419 - 65,037,602 (+) NCBI mRatBN7.2 13 62,424,312 - 62,487,496 (+) NCBI Rnor_6.0 13 67,611,708 - 67,672,827 (+) NCBI Rnor_5.0 13 72,576,506 - 72,637,654 (+) NCBI RGSC_v3.4 13 64,688,585 - 64,753,555 (+) RGD Celera 13 62,384,785 - 62,447,122 (+) RGD
Sequence:
AAGAGAGTGAGGCCTGCACCCCGCCCCTTTCGGGGCACCCTTGGGATCGTGGCGGTAGCCCAGAGCCTTTCGGGACGCCCTGCCGTGATCCGTGCCCTCTAGTGGCTCGGTTTCTAGAAGTGGCCAGA
hide sequence
RefSeq Acc Id:
XM_017598809 ⟹ XP_017454298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 64,974,444 - 65,037,604 (+) NCBI mRatBN7.2 13 62,424,334 - 62,487,502 (+) NCBI Rnor_6.0 13 67,611,685 - 67,672,833 (+) NCBI
Sequence:
CCATCTCCGCAGCTCTTCTACCAAAGAGAGTGAGGCCTGCACCCCGCCCCTTTCGGGGCACCCTTGGGATCGTGGCGGTAGCCCAGAGCCTTTCGGGACGCCCTGCCGTGATCCGTGCCCTCTAGTGG
hide sequence
RefSeq Acc Id:
NP_001100655 ⟸ NM_001107185
- UniProtKB:
Q3T1J7 (UniProtKB/Swiss-Prot), F1MA98 (UniProtKB/Swiss-Prot), A0A8L2UNA6 (UniProtKB/TrEMBL)
- Sequence:
MTSRGFDGSRRGSLRRAGARETASEAADGAAQASGLRASPCSFASPSAAAATTPADMAAVLQQVLERPELNKLPKSTQNKLEKFLAEQQSEIDCLKGRHEKFKVESEQQYFEIEKRLSQSQERLVNET
hide sequence
RefSeq Acc Id:
XP_017454298 ⟸ XM_017598809
- Peptide Label:
isoform X1
- UniProtKB:
Q3T1J7 (UniProtKB/Swiss-Prot), F1MA98 (UniProtKB/Swiss-Prot), A0A8I6ALQ6 (UniProtKB/TrEMBL)
- Sequence:
MTSRGFDGSRRGSLRRAGARETASEAADGAAQASGLRASPCSFASPSAAAATTPADMAAVLQQVLERPELNKLPKSTQNKLEKFLAEQQSEIDCLKGRHEKFKVESEQQYFEIEKRLSQSQERLVNET
hide sequence
Ensembl Acc Id:
ENSRNOP00000062172 ⟸ ENSRNOT00000063833
Ensembl Acc Id:
ENSRNOP00000094758 ⟸ ENSRNOT00000097761
RGD ID: 13698879 Promoter ID: EPDNEW_R9404 Type: initiation region Name: Tpr_1 Description: translocated promoter region, nuclear basket protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 67,611,656 - 67,611,716 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-16
Tpr
translocated promoter region, nuclear basket protein
Tpr
translocated promoter region (to activated MET oncogene)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-02-02
Tpr
translocated promoter region (to activated MET oncogene)
Tpr
translocated promoter region
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Tpr
translocated promoter region
Tpr_predicted
translocated promoter region (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tpr_predicted
translocated promoter region (predicted)
Symbol and Name status set to approved
70820 APPROVED
