Symbol:
Cyfip1
Name:
cytoplasmic FMR1 interacting protein 1
RGD ID:
1310332
Description:
Enables RNA 7-methylguanosine cap binding activity. Involved in several processes, including cellular response to insulin stimulus; negative regulation of synaptic vesicle recycling; and positive regulation of cell projection organization. Located in several cellular components, including dendritic spine; distal axon; and filopodium tip. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in autism spectrum disorder and schizophrenia. Orthologous to human CYFIP1 (cytoplasmic FMR1 interacting protein 1); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rho/Rac/Cdc42 mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cytoplasmic FMR1-interacting protein 1; LOC308666
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Cyfip1em1Sage
Genetic Models:
LE-Cyfip1em1Sage+/-
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 115,842,754 - 115,935,163 (+) NCBI GRCr8 mRatBN7.2 1 106,710,924 - 106,799,393 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 106,711,016 - 106,799,386 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 112,100,298 - 112,189,006 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 120,572,167 - 120,660,875 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 113,821,095 - 113,909,828 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 114,258,773 - 114,347,138 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 114,258,719 - 114,347,137 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 115,265,128 - 115,353,515 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 107,245,993 - 107,334,337 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 107,324,324 - 107,412,679 (+) NCBI Celera 1 100,921,447 - 101,009,775 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cyfip1 Rat 1,2-dimethylhydrazine decreases expression ISO Cyfip1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CYFIP1 mRNA CTD PMID:22206623 Cyfip1 Rat 17alpha-ethynylestradiol multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CYFIP1 mRNA CTD PMID:17942748 Cyfip1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CYFIP1 mRNA CTD PMID:17942748 Cyfip1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYFIP1 mRNA CTD PMID:33387578 Cyfip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CYFIP1 mRNA CTD PMID:34747641 Cyfip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cyfip1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CYFIP1 mRNA CTD PMID:21570461 Cyfip1 Rat 2,6-dimethoxyphenol multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of CYFIP1 protein CTD PMID:38598786 Cyfip1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CYFIP1 mRNA CTD PMID:21346803 Cyfip1 Rat 2-methylcholine affects expression ISO CYFIP1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CYFIP1 mRNA CTD PMID:21179406 Cyfip1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CYFIP1 mRNA CTD PMID:30071829 Cyfip1 Rat 4,4'-sulfonyldiphenol increases expression ISO CYFIP1 (Homo sapiens) 6480464 bisphenol S results in increased expression of CYFIP1 protein CTD PMID:34186270 Cyfip1 Rat aflatoxin B1 increases methylation ISO CYFIP1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CYFIP1 gene CTD PMID:27153756 Cyfip1 Rat all-trans-retinoic acid decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CYFIP1 mRNA CTD PMID:33167477 Cyfip1 Rat arsane affects methylation ISO CYFIP1 (Homo sapiens) 6480464 Arsenic affects the methylation of CYFIP1 gene CTD PMID:25304211 Cyfip1 Rat arsenic atom affects methylation ISO CYFIP1 (Homo sapiens) 6480464 Arsenic affects the methylation of CYFIP1 gene CTD PMID:25304211 Cyfip1 Rat arsenite(3-) multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CYFIP1 mRNA] and arsenite inhibits the reaction [G3BP1 protein binds to CYFIP1 protein] CTD PMID:32406909 Cyfip1 Rat Azoxymethane multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP1 mRNA CTD PMID:29950665 Cyfip1 Rat belinostat decreases expression ISO CYFIP1 (Homo sapiens) 6480464 belinostat results in decreased expression of CYFIP1 mRNA CTD PMID:27188386 Cyfip1 Rat benzo[a]pyrene affects methylation ISO Cyfip1 (Mus musculus) 6480464 Benzo(a)pyrene affects the methylation of CYFIP1 intron CTD PMID:27901495 Cyfip1 Rat benzo[a]pyrene decreases methylation ISO CYFIP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CYFIP1 promoter CTD PMID:27901495 Cyfip1 Rat benzo[a]pyrene affects methylation ISO CYFIP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CYFIP1 5' UTR CTD PMID:27901495 Cyfip1 Rat benzo[a]pyrene increases methylation ISO Cyfip1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of CYFIP1 exon CTD PMID:27901495 Cyfip1 Rat benzo[e]pyrene increases methylation ISO CYFIP1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CYFIP1 intron CTD PMID:30157460 Cyfip1 Rat benzoates decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Benzoates analog results in decreased expression of CYFIP1 mRNA CTD PMID:29472718 Cyfip1 Rat beta-lapachone decreases expression ISO CYFIP1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CYFIP1 mRNA CTD PMID:38218311 Cyfip1 Rat beta-lapachone increases expression ISO CYFIP1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CYFIP1 mRNA CTD PMID:38218311 Cyfip1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cyfip1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CYFIP1 mRNA CTD PMID:33754040 and PMID:34319233 Cyfip1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CYFIP1 mRNA CTD PMID:25181051 Cyfip1 Rat bisphenol A multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CYFIP1 gene CTD PMID:31601247 Cyfip1 Rat bisphenol A increases expression ISO CYFIP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CYFIP1 protein CTD PMID:37567409 Cyfip1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CYFIP1 mRNA CTD PMID:30816183 and PMID:34947998 Cyfip1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CYFIP1 gene CTD PMID:28505145 Cyfip1 Rat Bisphenol B increases expression ISO CYFIP1 (Homo sapiens) 6480464 bisphenol B results in increased expression of CYFIP1 protein CTD PMID:34186270 Cyfip1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CYFIP1 mRNA CTD PMID:33453195 Cyfip1 Rat caffeine decreases phosphorylation ISO CYFIP1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CYFIP1 protein CTD PMID:35688186 Cyfip1 Rat CGP 52608 multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CYFIP1 gene] CTD PMID:28238834 Cyfip1 Rat chlorpyrifos decreases expression ISO Cyfip1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CYFIP1 mRNA CTD PMID:37019170 Cyfip1 Rat choline multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CYFIP1 gene CTD PMID:20938992 Cyfip1 Rat cobalt dichloride decreases expression ISO CYFIP1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CYFIP1 mRNA CTD PMID:19320972 Cyfip1 Rat cobalt dichloride increases expression ISO Cyfip1 (Mus musculus) 6480464 cobaltous chloride results in increased expression of CYFIP1 mRNA CTD PMID:21139344 Cyfip1 Rat crocidolite asbestos increases expression ISO Cyfip1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of CYFIP1 mRNA CTD PMID:29279043 Cyfip1 Rat cyclosporin A decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CYFIP1 mRNA CTD PMID:20106945 Cyfip1 Rat dextran sulfate multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP1 mRNA CTD PMID:29950665 Cyfip1 Rat dorsomorphin multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CYFIP1 mRNA CTD PMID:27188386 Cyfip1 Rat doxorubicin increases expression ISO CYFIP1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of CYFIP1 mRNA CTD PMID:29803840 Cyfip1 Rat entinostat multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CYFIP1 mRNA CTD PMID:27188386 Cyfip1 Rat entinostat decreases expression ISO CYFIP1 (Homo sapiens) 6480464 entinostat results in decreased expression of CYFIP1 mRNA CTD PMID:26272509 Cyfip1 Rat enzyme inhibitor multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CYFIP1 protein CTD PMID:23301498 Cyfip1 Rat ethanol increases expression ISO Cyfip1 (Mus musculus) 6480464 Ethanol results in increased expression of CYFIP1 mRNA CTD PMID:30319688 Cyfip1 Rat ethanol affects splicing ISO Cyfip1 (Mus musculus) 6480464 Ethanol affects the splicing of CYFIP1 mRNA CTD PMID:30319688 Cyfip1 Rat folic acid multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CYFIP1 gene CTD PMID:20938992 Cyfip1 Rat fulvestrant multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CYFIP1 gene CTD PMID:31601247 Cyfip1 Rat furfural multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Cyfip1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CYFIP1 mRNA CTD PMID:33387578 Cyfip1 Rat ivermectin decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CYFIP1 protein CTD PMID:32959892 Cyfip1 Rat L-methionine multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CYFIP1 gene CTD PMID:20938992 Cyfip1 Rat methapyrilene increases methylation ISO CYFIP1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CYFIP1 intron CTD PMID:30157460 Cyfip1 Rat paracetamol affects expression ISO Cyfip1 (Mus musculus) 6480464 Acetaminophen affects the expression of CYFIP1 mRNA CTD PMID:17562736 Cyfip1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CYFIP1 mRNA CTD PMID:33387578 Cyfip1 Rat pirinixic acid decreases expression ISO Cyfip1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CYFIP1 mRNA CTD PMID:18445702 Cyfip1 Rat resveratrol multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of CYFIP1 mRNA CTD PMID:23557933 Cyfip1 Rat SB 431542 multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Cyfip1 Rat sodium arsenite increases expression ISO Cyfip1 (Mus musculus) 6480464 sodium arsenite results in increased expression of CYFIP1 protein CTD PMID:29044176 Cyfip1 Rat sodium chloride multiple interactions ISO CYFIP1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of CYFIP1 protein CTD PMID:38598786 Cyfip1 Rat sodium dichromate decreases expression ISO CYFIP1 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of CYFIP1 mRNA CTD PMID:17685462 Cyfip1 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of CYFIP1 mRNA CTD PMID:26141394 Cyfip1 Rat temozolomide decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CYFIP1 mRNA CTD PMID:31758290 Cyfip1 Rat thapsigargin increases expression ISO Cyfip1 (Mus musculus) 6480464 Thapsigargin results in increased expression of CYFIP1 protein CTD PMID:24648495 Cyfip1 Rat titanium dioxide increases expression ISO Cyfip1 (Mus musculus) 6480464 titanium dioxide results in increased expression of CYFIP1 mRNA CTD PMID:29128614 and PMID:29264374 Cyfip1 Rat titanium dioxide multiple interactions ISO Cyfip1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CYFIP1 mRNA CTD PMID:29950665 Cyfip1 Rat triptonide increases expression ISO Cyfip1 (Mus musculus) 6480464 triptonide results in increased expression of CYFIP1 mRNA CTD PMID:33045310 Cyfip1 Rat valproic acid affects expression ISO CYFIP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CYFIP1 mRNA CTD PMID:25979313 Cyfip1 Rat valproic acid decreases expression ISO CYFIP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CYFIP1 mRNA CTD PMID:24935251 and PMID:28001369 Cyfip1 Rat valproic acid increases methylation ISO CYFIP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CYFIP1 gene CTD PMID:29154799 Cyfip1 Rat vitamin E increases expression ISO CYFIP1 (Homo sapiens) 6480464 Vitamin E results in increased expression of CYFIP1 mRNA CTD PMID:19244175 Cyfip1 Rat vorinostat decreases expression ISO CYFIP1 (Homo sapiens) 6480464 vorinostat results in decreased expression of CYFIP1 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) benzoates (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) cadmium dichloride (EXP) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dextran sulfate (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (ISO) folic acid (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) ivermectin (ISO) L-methionine (ISO) methapyrilene (ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (ISO) T-2 toxin (EXP) temozolomide (ISO) thapsigargin (ISO) titanium dioxide (ISO) triptonide (ISO) valproic acid (ISO) vitamin E (ISO) vorinostat (ISO)
1.
Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice.
Bozdagi O, etal., PLoS One. 2012;7(8):e42422. doi: 10.1371/journal.pone.0042422. Epub 2012 Aug 10.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Cyfip1 Regulates Presynaptic Activity during Development.
Hsiao K, etal., J Neurosci. 2016 Feb 3;36(5):1564-76. doi: 10.1523/JNEUROSCI.0511-15.2016.
4.
Up-regulated cytoplasmic FMRP-interacting protein 1 in intractable temporal lobe epilepsy patients and a rat model.
Huang Y Int J Neurosci. 2015 Aug 24:1-10.
5.
CRMP-2 is involved in kinesin-1-dependent transport of the Sra-1/WAVE1 complex and axon formation.
Kawano Y, etal., Mol Cell Biol. 2005 Nov;25(22):9920-35.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
The Prader-Willi phenotype of fragile X syndrome.
Nowicki ST, etal., J Dev Behav Pediatr. 2007 Apr;28(2):133-8.
8.
Two-stage translational control of dentate gyrus LTP consolidation is mediated by sustained BDNF-TrkB signaling to MNK.
Panja D, etal., Cell Rep. 2014 Nov 20;9(4):1430-45. doi: 10.1016/j.celrep.2014.10.016. Epub 2014 Nov 6.
9.
The autism and schizophrenia associated gene CYFIP1 is critical for the maintenance of dendritic complexity and the stabilization of mature spines.
Pathania M, etal., Transl Psychiatry. 2014 Mar 25;4:e374. doi: 10.1038/tp.2014.16.
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
13.
Cyfip1 haploinsufficient rats show white matter changes, myelin thinning, abnormal oligodendrocytes and behavioural inflexibility.
Silva AI, etal., Nat Commun. 2019 Aug 1;10(1):3455. doi: 10.1038/s41467-019-11119-7.
14.
Confirmed rare copy number variants implicate novel genes in schizophrenia.
Tam GW, etal., Biochem Soc Trans. 2010 Apr;38(2):445-51. doi: 10.1042/BST0380445.
15.
A co-segregating microduplication of chromosome 15q11.2 pinpoints two risk genes for autism spectrum disorder.
van der Zwaag B, etal., Am J Med Genet B Neuropsychiatr Genet. 2010 Jun 5;153B(4):960-6. doi: 10.1002/ajmg.b.31055.
16.
Common variants in genes of the postsynaptic FMRP signalling pathway are risk factors for autism spectrum disorders.
Waltes R, etal., Hum Genet. 2014 Jun;133(6):781-92. doi: 10.1007/s00439-013-1416-y. Epub 2014 Jan 19.
Cyfip1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 115,842,754 - 115,935,163 (+) NCBI GRCr8 mRatBN7.2 1 106,710,924 - 106,799,393 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 106,711,016 - 106,799,386 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 112,100,298 - 112,189,006 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 120,572,167 - 120,660,875 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 113,821,095 - 113,909,828 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 114,258,773 - 114,347,138 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 114,258,719 - 114,347,137 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 115,265,128 - 115,353,515 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 107,245,993 - 107,334,337 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 107,324,324 - 107,412,679 (+) NCBI Celera 1 100,921,447 - 101,009,775 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
CYFIP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 22,867,052 - 22,980,898 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 22,867,052 - 22,981,063 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 22,892,170 - 23,006,016 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 20,444,125 - 20,555,044 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 20,444,124 - 20,555,043 NCBI Celera 15 1,376,209 - 1,487,232 (-) NCBI Celera Cytogenetic Map 15 q11.2 NCBI HuRef 15 1,205,387 - 1,315,987 (+) NCBI HuRef CHM1_1 15 22,841,725 - 22,952,892 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 20,538,904 - 20,652,761 (-) NCBI T2T-CHM13v2.0
Cyfip1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 55,491,556 - 55,582,381 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 55,491,493 - 55,582,350 (+) Ensembl GRCm39 Ensembl GRCm38 7 55,842,022 - 55,932,633 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 55,841,745 - 55,932,602 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 63,097,441 - 63,188,003 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 55,739,875 - 55,798,505 (+) NCBI MGSCv36 mm8 Celera 7 53,195,732 - 53,286,248 (+) NCBI Celera Cytogenetic Map 7 B5 NCBI cM Map 7 33.42 NCBI
CYFIP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 12,204,434 - 12,315,794 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 15,928,676 - 16,042,452 (-) NCBI NHGRI_mPanPan1 PanPan1.1 15 20,462,755 - 20,573,684 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 20,462,811 - 20,573,684 (+) Ensembl panpan1.1 panPan2
CYFIP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 32,096,471 - 32,170,107 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 32,097,037 - 32,187,781 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 34,509,239 - 34,585,945 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 32,162,887 - 32,239,605 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 32,117,281 - 32,240,269 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 31,650,943 - 31,773,999 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 31,945,859 - 32,022,546 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 32,056,552 - 32,133,289 (+) NCBI UU_Cfam_GSD_1.0
Cyfip1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 120,416,388 - 120,482,622 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 38,267,703 - 38,332,218 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 38,264,455 - 38,331,995 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYFIP1
CYFIP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 53,562,105 - 53,673,544 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 53,595,767 - 53,672,977 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 36,289,010 - 36,405,036 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cyfip1
.
Predicted Target Of
Count of predictions: 372 Count of miRNA genes: 207 Interacting mature miRNAs: 250 Transcripts: ENSRNOT00000016376 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 631569 Bp93 Blood pressure QTL 93 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 121834139 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
This gene Cyfip1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016376 ⟹ ENSRNOP00000016376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 106,711,016 - 106,799,386 (+) Ensembl Rnor_6.0 Ensembl 1 114,258,793 - 114,347,137 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088459 ⟹ ENSRNOP00000072931
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 106,711,016 - 106,799,386 (+) Ensembl Rnor_6.0 Ensembl 1 114,258,719 - 114,346,800 (+) Ensembl
RefSeq Acc Id:
NM_001107517 ⟹ NP_001100987
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,846,820 - 115,935,162 (+) NCBI mRatBN7.2 1 106,711,048 - 106,799,392 (+) NCBI Rnor_6.0 1 114,258,793 - 114,347,137 (+) NCBI Rnor_5.0 1 115,265,128 - 115,353,515 (+) NCBI RGSC_v3.4 1 107,245,993 - 107,334,337 (+) RGD Celera 1 100,921,447 - 101,009,775 (+) RGD
Sequence:
TCCTGGTGCATTCCCGACCCGCCCGAGTGACTCACTGGGGTAGGAAAGCTCCCGGGCCGCCCTGGACAACCGAAGGCGGCTCAGACCAGGATGGCTGCCCAAGTGACACTAGAGGACGCACTGTCCAA
hide sequence
RefSeq Acc Id:
XM_006229288 ⟹ XP_006229350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,842,754 - 115,935,163 (+) NCBI mRatBN7.2 1 106,742,524 - 106,799,393 (+) NCBI Rnor_6.0 1 114,258,773 - 114,347,138 (+) NCBI Rnor_5.0 1 115,265,128 - 115,353,515 (+) NCBI
Sequence:
AGGGGAGGAGGCCGGGTGTTTCCTGGTGCATTCCCGACCCGCCCGAGTGACTCACTGGGGTAGG
hide sequence
RefSeq Acc Id:
XM_039112486 ⟹ XP_038968414
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,842,754 - 115,935,163 (+) NCBI mRatBN7.2 1 106,710,924 - 106,798,857 (+) NCBI
RefSeq Acc Id:
XM_039112492 ⟹ XP_038968420
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,878,294 - 115,929,723 (+) NCBI mRatBN7.2 1 106,742,524 - 106,793,953 (+) NCBI
RefSeq Acc Id:
XM_039112494 ⟹ XP_038968422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,878,294 - 115,912,506 (+) NCBI mRatBN7.2 1 106,742,524 - 106,776,736 (+) NCBI
RefSeq Acc Id:
XM_063262335 ⟹ XP_063118405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,842,754 - 115,935,163 (+) NCBI
RefSeq Acc Id:
XM_063262343 ⟹ XP_063118413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 115,842,754 - 115,935,163 (+) NCBI
RefSeq Acc Id:
NP_001100987 ⟸ NM_001107517
- UniProtKB:
D4A8H8 (UniProtKB/TrEMBL), A6KD28 (UniProtKB/TrEMBL)
- Sequence:
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYF
hide sequence
RefSeq Acc Id:
XP_006229350 ⟸ XM_006229288
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K472 (UniProtKB/TrEMBL)
- Sequence:
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYF
hide sequence
Ensembl Acc Id:
ENSRNOP00000016376 ⟸ ENSRNOT00000016376
Ensembl Acc Id:
ENSRNOP00000072931 ⟸ ENSRNOT00000088459
RefSeq Acc Id:
XP_038968414 ⟸ XM_039112486
- Peptide Label:
isoform X2
- UniProtKB:
D4A8H8 (UniProtKB/TrEMBL), A6KD28 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968420 ⟸ XM_039112492
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038968422 ⟸ XM_039112494
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063118413 ⟸ XM_063262343
- Peptide Label:
isoform X2
- UniProtKB:
A6KD28 (UniProtKB/TrEMBL), D4A8H8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118405 ⟸ XM_063262335
- Peptide Label:
isoform X1
RGD ID: 13690084 Promoter ID: EPDNEW_R608 Type: initiation region Name: Cyfip1_1 Description: cytoplasmic FMR1 interacting protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 114,258,808 - 114,258,868 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Cyfip1
cytoplasmic FMR1 interacting protein 1
Cyfip1_predicted
cytoplasmic FMR1 interacting protein 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Cyfip1_predicted
cytoplasmic FMR1 interacting protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
