Advanced Search (OLGA)

Gene: Gp1ba (glycoprotein Ib platelet subunit alpha) Rattus norvegicus

Analyze

Symbol:

Gp1ba

Name:

glycoprotein Ib platelet subunit alpha

RGD ID:

1310239

Description:

Predicted to enable signaling receptor activity. Involved in positive regulation of leukocyte tethering or rolling. Predicted to be located in external side of plasma membrane. Predicted to be part of glycoprotein Ib-IX-V complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Bernard-Soulier syndrome; Bernard-Soulier syndrome type A2; myocardial infarction; non-arteritic anterior ischemic optic neuropathy; and platelet-type bleeding disorder 3. Orthologous to human GP1BA (glycoprotein Ib platelet subunit alpha); PARTICIPATES IN platelet aggregation pathway; cell-extracellular matrix signaling pathway; INTERACTS WITH bisphenol A; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glycoprotein 1b, alpha polypeptide; glycoprotein 1b, alpha polypeptide (predicted); glycoprotein Ib (platelet), alpha polypeptide; glycoprotein Ib platelet alpha subunit; Gp1ba_predicted; LOC287460; LOC691992; platelet glycoprotein Ib alpha chain; similar to glycoprotein 1b, alpha polypeptide

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,831,901 - 55,856,729 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,829,832 - 55,854,560 (+)	Ensembl				GRCr8
mRatBN7.2	10	55,352,938 - 55,355,804 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,352,899 - 55,356,774 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	60,033,557 - 60,036,423 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,522,063 - 59,524,929 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	55,021,168 - 55,024,034 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,260,680 - 57,263,546 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,260,680 - 57,263,546 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	57,004,387 - 57,010,497 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	57,519,338 - 57,522,204 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	54,498,496 - 54,501,362 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune thrombocytopenic purpura (ISO)

bacterial pneumonia (ISO)

Bernard-Soulier syndrome (ISO,ISS)

Bernard-Soulier Syndrome Type A1 (ISO)

Bernard-Soulier syndrome type A2 (ISO)

Bernard-Soulier Syndrome, Autosomal Dominant (ISO)

brain ischemia (ISO)

chronic kidney disease (ISO)

CIC-rearranged sarcoma (ISO)

Coronary Disease (ISO)

diabetic angiopathy (ISO)

Diarrhea prodrome + Hemolytic-Uremic Syndrome (ISO)

Embolism (ISO)

genetic disease (ISO)

hemorrhagic disease (ISO)

hypertension (ISO)

liver cirrhosis (ISO)

myocardial infarction (ISO)

Neoplasm Metastasis (ISO)

nephrotic syndrome (ISO)

non-arteritic anterior ischemic optic neuropathy (ISO)

peritoneum cancer (ISO)

peritonitis (ISO)

platelet-type bleeding disorder 3 (ISO)

Sepsis (ISO)

thrombocytopenia (ISO)

thrombosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

acetylsalicylic acid (ISO)

amphotericin B (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

atrazine (ISO)

benzene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

cholesterol (ISO)

copper atom (EXP)

copper(0) (EXP)

Dibutyl phosphate (ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

N-acetyl-L-cysteine (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP)

phorbol 13-acetate 12-myristate (ISO)

potassium dichromate (ISO)

prothioconazole (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

testosterone (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood coagulation (IEA,ISO)

blood coagulation, intrinsic pathway (IBA,ISO)

cell adhesion (IEA,ISO)

cell morphogenesis (ISO)

fibrinolysis (ISO)

hemostasis (IEA,ISO)

megakaryocyte development (ISO)

positive regulation of leukocyte tethering or rolling (IMP)

positive regulation of platelet activation (ISO)

release of sequestered calcium ion into cytosol (ISO)

Cellular Component

cell surface (ISO)

external side of plasma membrane (ISO)

membrane (IEA,ISO)

plasma membrane (IBA,ISO)

Molecular Function

protein binding (ISO)

signaling receptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

cell-extracellular matrix signaling pathway (IEA)

platelet aggregation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The variable number of tandem repeat polymorphism of platelet glycoprotein Ibalpha and risk of coronary heart disease.	Afshar-Kharghan V, etal., Blood. 2004 Feb 1;103(3):963-5. Epub 2003 Oct 30.
2.	Novel genetic abnormalities in Bernard-Soulier syndrome in India.	Ali S, etal., Ann Hematol. 2014 Mar;93(3):381-4. doi: 10.1007/s00277-013-1895-x. Epub 2013 Sep 1.
3.	Bernard-Soulier syndrome: common ancestry in two African American families with the GP Ib alpha Leu129Pro mutation.	Antonucci JV, etal., Am J Hematol. 2000 Oct;65(2):141-8.
4.	The vascular biology of the glycoprotein Ib-IX-V complex.	Berndt MC, etal., Thromb Haemost. 2001 Jul;86(1):178-88.
5.	GPIb VNTR C/C genotype may predict embolic events in infective endocarditis.	Daga S, etal., J Heart Valve Dis. 2013 Jan;22(1):133-41.
6.	Streptococcus pneumoniae worsens cerebral ischemia via interleukin 1 and platelet glycoprotein Ibα.	Dénes Á, etal., Ann Neurol. 2014 May;75(5):670-83. doi: 10.1002/ana.24146. Epub 2014 Apr 14.
7.	Inhibition of platelet GPIb alpha and promotion of melanoma metastasis.	Erpenbeck L, etal., J Invest Dermatol. 2010 Feb;130(2):576-86. doi: 10.1038/jid.2009.278. Epub 2009 Sep 3.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Compound heterozygosity of the GPIbalpha gene associated with Bernard-Soulier syndrome.	Gonzalez-Manchon C, etal., Thromb Haemost. 2001 Dec;86(6):1385-91.
11.	Risk of macrovascular complications in type 2 diabetes mellitus: endothelial microparticle profiles.	Jung KH, etal., Cerebrovasc Dis. 2011;31(5):485-93. doi: 10.1159/000324383. Epub 2011 Mar 16.
12.	Genetic Susceptibility to Postdiarrheal Hemolytic-Uremic Syndrome After Shiga Toxin-Producing Escherichia coli Infection: A Centers for Disease Control and Prevention FoodNet Study.	Kallianpur AR, etal., J Infect Dis. 2018 Mar 5;217(6):1000-1010. doi: 10.1093/infdis/jix633.
13.	Correction of murine Bernard-Soulier syndrome by lentivirus-mediated gene therapy.	Kanaji S, etal., Mol Ther. 2012 Mar;20(3):625-32. doi: 10.1038/mt.2011.231. Epub 2011 Nov 1.
14.	Molecular characterization of two mutations in platelet glycoprotein (GP) Ib alpha in two Finnish Bernard-Soulier syndrome families.	Koskela S, etal., Eur J Haematol. 1999 Mar;62(3):160-8.
15.	A revised model of platelet aggregation.	Kulkarni S, etal., J Clin Invest. 2000 Mar;105(6):783-91.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Mutation in the gene encoding the alpha chain of platelet glycoprotein Ib in platelet-type von Willebrand disease.	Miller JL, etal., Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):4761-5.
18.	Carbon monoxide modulates endotoxin-induced microvascular leukocyte adhesion through platelet-dependent mechanisms.	Morisaki H, etal., Anesthesiology. 2002 Sep;97(3):701-9. doi: 10.1097/00000542-200209000-00025.
19.	Identification of critical antigen-specific mechanisms in the development of immune thrombocytopenic purpura in mice.	Nieswandt B, etal., Blood. 2000 Oct 1;96(7):2520-7.
20.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
21.	Identification and functional characterization of a novel 27-bp deletion in the macroglycopeptide-coding region of the GPIBA gene resulting in platelet-type von Willebrand disease.	Othman M, etal., Blood. 2005 Jun 1;105(11):4330-6. Epub 2005 Feb 10.
22.	Platelet glycoprotein Ibalpha polymorphisms modulate the risk for myocardial infarction.	Ozelo MC, etal., Thromb Haemost. 2004 Aug;92(2):384-6.
23.	von Willebrand factor promotes leukocyte extravasation.	Petri B, etal., Blood. 2010 Nov 25;116(22):4712-9. doi: 10.1182/blood-2010-03-276311. Epub 2010 Aug 17.
24.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
25.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
27.	Comprehensive gene review and curation	RGD comprehensive gene curation
28.	Directed transport of neutrophil-derived extracellular vesicles enables platelet-mediated innate immune response.	Rossaint J, etal., Nat Commun. 2016 Nov 15;7:13464. doi: 10.1038/ncomms13464.
29.	Role of platelet surface receptor abnormalities in the bleeding and thrombotic diathesis of uremic patients on hemodialysis and peritoneal dialysis.	Salvati F and Liani M, Int J Artif Organs. 2001 Mar;24(3):131-5.
30.	Autosomal dominant macrothrombocytopenia in Italy is most frequently a type of heterozygous Bernard-Soulier syndrome.	Savoia A, etal., Blood. 2001 Mar 1;97(5):1330-5.
31.	Clinical and genetic aspects of Bernard-Soulier syndrome: searching for genotype/phenotype correlations.	Savoia A, etal., Haematologica. 2011 Mar;96(3):417-23. doi: 10.3324/haematol.2010.032631. Epub 2010 Dec 20.
32.	Substitution of Val for Met at residue 239 of platelet glycoprotein Ib alpha in Japanese patients with platelet-type von Willebrand disease.	Takahashi H, etal., Blood. 1995 Feb 1;85(3):727-33.
33.	Surface markers of platelet function in idiopathic nephrotic syndrome in children.	Tkaczyk M and Baj Z, Pediatr Nephrol. 2002 Aug;17(8):673-7. Epub 2002 May 17.
34.	Novel point mutation in a leucine-rich repeat of the GPIbalpha chain of the platelet von Willebrand factor receptor, GPIb/IX/V, resulting in an inherited dominant form of Bernard-Soulier syndrome affecting two unrelated families: the N41H variant.	Vettore S, etal., Haematologica. 2008 Nov;93(11):1743-7. doi: 10.3324/haematol.12830. Epub 2008 Sep 24.
35.	Point mutation in a leucine-rich repeat of platelet glycoprotein Ib alpha resulting in the Bernard-Soulier syndrome.	Ware J, etal., J Clin Invest. 1993 Sep;92(3):1213-20.
36.	Relative efficacy of intravenous immunoglobulin G in ameliorating thrombocytopenia induced by antiplatelet GPIIbIIIa versus GPIbalpha antibodies.	Webster ML, etal., Blood. 2006 Aug 1;108(3):943-6.
37.	Platelets protect from septic shock by inhibiting macrophage-dependent inflammation via the cyclooxygenase 1 signalling pathway.	Xiang B, etal., Nat Commun. 2013;4:2657. doi: 10.1038/ncomms3657.
38.	Extravasated platelet aggregation contributes to tumor progression via the accumulation of myeloid-derived suppressor cells in gastric cancer with peritoneal metastasis.	Yamaguchi T, etal., Oncol Lett. 2020 Aug;20(2):1879-1887. doi: 10.3892/ol.2020.11722. Epub 2020 Jun 10.
39.	Improvement of human platelet aggregation post-splenectomy with paraesophagogastric devascularization in chronic hepatitis B patients with cirrhotic hypersplenism.	Zhang H, etal., Platelets. 2020 Nov 16;31(8):1019-1027. doi: 10.1080/09537104.2019.1704715. Epub 2019 Dec 18.
40.	A large Swiss family with Bernard-Soulier syndrome - Correlation phenotype and genotype.	Zieger B, etal., Hamostaseologie. 2009 May;29(2):161-7.

Additional References at PubMed

PMID:9410473	PMID:10706630	PMID:12855810	PMID:15297306	PMID:19017648	PMID:19443707	PMID:20650879	PMID:21037087	PMID:23382103	PMID:23533145

Genomics

Comparative Map Data

Gp1ba
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,831,901 - 55,856,729 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,829,832 - 55,854,560 (+)	Ensembl				GRCr8
mRatBN7.2	10	55,352,938 - 55,355,804 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,352,899 - 55,356,774 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	60,033,557 - 60,036,423 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,522,063 - 59,524,929 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	55,021,168 - 55,024,034 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,260,680 - 57,263,546 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,260,680 - 57,263,546 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	57,004,387 - 57,010,497 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	57,519,338 - 57,522,204 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	54,498,496 - 54,501,362 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

GP1BA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	4,932,277 - 4,935,023 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	4,932,277 - 4,935,023 (+)	Ensembl			hg38	GRCh38
GRCh37	17	4,835,572 - 4,838,318 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	4,776,372 - 4,779,067 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	4,776,371 - 4,779,066	NCBI
Celera	17	4,850,477 - 4,853,133 (+)	NCBI		Celera
Cytogenetic Map	17	p13.2	NCBI
HuRef	17	4,723,218 - 4,725,913 (+)	NCBI		HuRef
CHM1_1	17	4,844,928 - 4,847,662 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	4,822,661 - 4,825,369 (+)	NCBI		T2T-CHM13v2.0

Gp1ba
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	70,529,928 - 70,534,812 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	70,529,948 - 70,532,862 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	70,639,102 - 70,643,986 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	70,639,122 - 70,642,036 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	70,452,624 - 70,455,560 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	70,455,317 - 70,458,253 (+)	NCBI		MGSCv36	mm8
Celera	11	78,190,097 - 78,193,033 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	43.2	NCBI

Gp1ba
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	10,333,575 - 10,346,989 (+)	Ensembl
ChiLan1.0	NW_004955467	10,333,537 - 10,347,488 (+)	NCBI	ChiLan1.0	ChiLan1.0

GP1BA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	12,542,533 - 12,547,695 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	14,494,488 - 14,516,053 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	4,980,083 - 4,983,219 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	4,968,328 - 4,970,711 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

GP1BA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	31,681,605 - 31,683,261 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	31,819,615 - 31,822,278 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	31,785,030 - 31,787,703 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	31,785,476 - 31,787,513 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	31,751,569 - 31,754,227 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	31,711,274 - 31,713,938 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	31,887,650 - 31,890,313 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gp1ba
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	53,122,017 - 53,125,833 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936677	2,774,076 - 2,779,660 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GP1BA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	51,975,874 - 51,977,757 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	51,975,810 - 51,979,428 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,042,717 - 54,048,185 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GP1BA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	4,412,693 - 4,415,841 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666059	17,217,911 - 17,221,384 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gp1ba
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624786	8,789,496 - 8,794,897 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gp1ba
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	50,250,778 - 50,253,358 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gp1ba
269 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	379
Count of miRNA genes:	222
Interacting mature miRNAs:	261
Transcripts:	ENSRNOT00000035445
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52699004	59876693	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	54296227	67476781	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	54296227	58944345	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	12	64	125	86	85	54	92	54	6	324	189	11	99	59	84	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035445 ⟹ ENSRNOP00000053510

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,829,832 - 55,854,560 (+)	Ensembl
mRatBN7.2 Ensembl	10	55,352,899 - 55,356,774 (+)	Ensembl
Rnor_6.0 Ensembl	10	57,260,680 - 57,263,546 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148191 ⟹ ENSRNOP00000112292

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,829,957 - 55,854,560 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000159517 ⟹ ENSRNOP00000105269

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,829,834 - 55,854,560 (+)	Ensembl

RefSeq Acc Id:

NM_001109654 ⟹ NP_001103124

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,851,559 - 55,854,425 (+)	NCBI
mRatBN7.2	10	55,352,938 - 55,355,804 (+)	NCBI
Rnor_6.0	10	57,260,680 - 57,263,546 (+)	NCBI
Rnor_5.0	10	57,004,387 - 57,010,497 (+)	NCBI
RGSC_v3.4	10	57,519,338 - 57,522,204 (+)	RGD
Celera	10	54,498,496 - 54,501,362 (+)	RGD

Sequence:

show sequence

TGGCTCTCCTTGGAGCTAGTAGAGAGGAGGACCGAGTCATACCCTGGAAGAAGCTCTGTGCCTT
CGGAGGTCTTTCTGCCTGACTGTTCACATGGCTCTCCTCATCTTGCTGTTCCTGCTGCCAAGTC
CCTTACACTCCCAGCCCACTTGTGATGTCTCCAAAGTGACCAGCCTGCTGGAAGTAAACTGTGA
GGACAAGAAGCTGAAAAAATTGCCTACAGACCTGCCAGCCGACACAGGCATCCTCCACCTGAGC
AAGAACCAACTGGGCACCTTCTCCACATCATACCTGGTGCATTTCACTCACCTTACTCACCTGT
ACCTGAGTAGATGTGAGCTGACCAGCCTGCAGGCCCATGAGAAACTGTTAAAGCTGGAAACCCT
GGACTTATCCCACAATCACCTGCAAAGTCTGCCCTCCCTAGGACGGGCACTGCCTGCACTCACT
ACTCTAGACGTCTCCTTCAACAAGCTGGGTTCACTGTCTCCTGGTGCCCTGGAAGGCCTGGGCC
AACTCGAGGAACTCTACTTGCAGAACAATGATCTTAAGAGTCTGCCCCCTGGGCTCTTAATGCC
CACAACTAAGCTGTTGAAACTCAGTCTGGCCAACAACAAACTTCGTGAGCTGCCCCCTGGGCTC
CTAGATGGACTAGAGGATCTTGACACCCTCTACCTTCAAGGGAACTGGCTCAGCACAATACCAA
AGGGCTTCTTTGGGTCCCTCCTCTTGCCTTTTGTTTTTCTCCATGCCAACACCTGGTACTGTGA
TTGTGAAATCCTCTACTTCCGTAACTGGCTCCAAGAAAACCCCAACCGTGTCTACTTATGGAAG
GAGGGTGTAGATGTCAAGGCCATGACTGCTAACGTGGCCAGTGTACGATGTGCCAATTTGGGCA
ATGCGCCTGTCTACTCCTACCCAGGGAAGGGCTGCCCTACCAATGAGGGTGACATAGACTATGA
TGACTATGCTGATACCCCTACCACAAGGACTGAGGTGAAGTTCTCTACTAACACTAAAGCTCAT
ACTACCTACTGGGGCCTATTCTACTCAGAGTCTTCCACTTCTCCAGACAGCCAAATGACTTCTT
TGCCTCCCATCCACGAACCCACTAAGAAACAACCTACATTTGCCCACACAGAGATCCCAGGTTT
CACCACACTCCCAGATACCATGGAATCCAACACAGCCTTCTACAGTCTAAACAATACTGTACCC
ACCACCACCCCAGAGCCCACCTCCACCCAGGCTACCCCAGAGCCCAGCAGCACCCCAATGCTTA
CCACTCCTGTGCCTACCCCAGAGCCCAGCAGCATCCCAATGCTTACCGTTCCTGTGTCTACCCC
AGAGCCCAGCAGCACCCCAATGCTTACCACTCCCGTGTCTACCCCAGAGCCCAGCAGCATCCCA
ATGCCTACCATTCCCGTGCCTACCCCAGAGCCCAGCAGCATCCCAATGCCTACCATTCCCGTGC
CTACCCCAGAGCCCAGCAGCACCCCAATGCCTACCATTCCTGTGCCTACCCCAGAGCCCAGCAG
CACCCCAATGTTTACCACACCTGTGCCTACCCCAGAGCCCAGCAGTACCCCAATGCTTACCACT
CCCACCCTGACTACCCCAGAGTCCAGCAGCACCCCAAGTATTCTAGTGTCTACTATCCCCCCAG
TGCTCACTACCACCCTGGCCCCTCCAGAGTCTATCCCAAAGACCGTTTTAGAACAATTTTATAC
CCTAGAGCCCACTTTACCCCGTACCTTAGAATCCACAATAATAATCCCAGAGCAGAATAGTCTA
AATTCCCAAGCGGTGCCTCAAGCAAGTTCTGATACTCCTAAAAGCAATCCTTTTCTCAACTCTG
ACTTCTGTTGCCTCCTCCCCCTGGGCTTCTATGTTCTGGGTCTCCTCTGGCTCTTATTTGCCTC
TGTGGTCCTCATTGTGTTGCTGACCTGGATCTGGCATGTGACACCGCACAATCTAGACATGGAC
CAATCTGCTGCACTGGCCACAAGCACACACACCACAAGCCTGGAAATGCAGAGAGCAAGGCAAG
TAACTATGCCCTGGGCCTGGCTGCTCTCCCTTCAAGGATCACTCCCTACTTTCCGGTCTAGCCT
TTTCCTGTGGGTAAGGCCTAATGGGCGTGTGGGGCCTCTGGTAGCAGGACGGAGACCCTCAGCT
CTGAGTCAGGGTCATGGTCAGGACCTATTGGGCAGAGTGGGTATTAGGTACTCAGGCCACAGTC
TGTGACAGTGAATGCTAAGACTTTACTGGACTCTCCTAGGACCTAGCTAGGACAGGAGGTTGAG
AGCATTACAGGACCTCCTATTTACTTCTCGTTTATCTGAAGCCCCTTCTTTACATCTAGGCACC
CAAATCCAAACCTTACAAATCAAGAGGTAGTGAGGTGATGTATCCCTGTGGTCACAGGACCAAC
CTCCCTCCGTTGCTTAGAGCATTGCCAGGCTACATGGTCACTACCACTTTGTGGGGGGAAAAAA
GAGCTGGAAAAAGCAGATAGGAATAGTGTGGCTCCCAAATGTTCACCCATGGAAGAAAACGTGG
AAAGTCATTCATCAGGATGGGAGCACTACCCCTAAGTATCATGAGTACTTTTCCCTTGGTTAAC
ACTCTGGTTTTCTACCAGTGTTATCATTTGTATAATAAAACTATTTTTTAAAA

hide sequence

RefSeq Acc Id:

XM_063269910 ⟹ XP_063125980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,831,901 - 55,856,729 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001103124	(Get FASTA)	NCBI Sequence Viewer
	XP_063125980	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM05027	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053510.2
	ENSRNOP00000105269
	ENSRNOP00000105269.1
	ENSRNOP00000112292.1

RefSeq Acc Id:	NP_001103124 ⟸ NM_001109654
- Peptide Label:	precursor
- UniProtKB:	A6HG72 (UniProtKB/TrEMBL), D3ZQU7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALLILLFLLPSPLHSQPTCDVSKVTSLLEVNCEDKKLKKLPTDLPADTGILHLSKNQLGTFST SYLVHFTHLTHLYLSRCELTSLQAHEKLLKLETLDLSHNHLQSLPSLGRALPALTTLDVSFNKL GSLSPGALEGLGQLEELYLQNNDLKSLPPGLLMPTTKLLKLSLANNKLRELPPGLLDGLEDLDT LYLQGNWLSTIPKGFFGSLLLPFVFLHANTWYCDCEILYFRNWLQENPNRVYLWKEGVDVKAMT ANVASVRCANLGNAPVYSYPGKGCPTNEGDIDYDDYADTPTTRTEVKFSTNTKAHTTYWGLFYS ESSTSPDSQMTSLPPIHEPTKKQPTFAHTEIPGFTTLPDTMESNTAFYSLNNTVPTTTPEPTST QATPEPSSTPMLTTPVPTPEPSSIPMLTVPVSTPEPSSTPMLTTPVSTPEPSSIPMPTIPVPTP EPSSIPMPTIPVPTPEPSSTPMPTIPVPTPEPSSTPMFTTPVPTPEPSSTPMLTTPTLTTPESS STPSILVSTIPPVLTTTLAPPESIPKTVLEQFYTLEPTLPRTLESTIIIPEQNSLNSQAVPQAS SDTPKSNPFLNSDFCCLLPLGFYVLGLLWLLFASVVLIVLLTWIWHVTPHNLDMDQSAALATST HTTSLEMQRARQVTMPWAWLLSLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGHGQDL LGRVGIRYSGHSL hide sequence

Ensembl Acc Id:

ENSRNOP00000053510 ⟸ ENSRNOT00000035445

RefSeq Acc Id:	XP_063125980 ⟸ XM_063269910
- Peptide Label:	isoform X1
- UniProtKB:	A6HG72 (UniProtKB/TrEMBL), D3ZQU7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105269 ⟸ ENSRNOT00000159517

Ensembl Acc Id:

ENSRNOP00000112292 ⟸ ENSRNOT00000148191

Protein Domains

LRRCT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQU7-F1-model_v2	AlphaFold	D3ZQU7	1-717	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697368

Promoter ID:

EPDNEW_R7891

Type:

single initiation site

Name:

Gp1ba_1

Description:

glycoprotein Ib platelet alpha subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	57,260,718 - 57,260,778	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310239	AgrOrtholog
BioCyc Gene	G2FUF-24442	BioCyc
Ensembl Genes	ENSRNOG00000025959	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000035445.6	UniProtKB/TrEMBL
	ENSRNOT00000148191.1	UniProtKB/TrEMBL
	ENSRNOT00000159517	ENTREZGENE
	ENSRNOT00000159517.1	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
InterPro	Cys-rich_flank_reg_C	UniProtKB/TrEMBL
	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
KEGG Report	rno:691992	UniProtKB/TrEMBL
NCBI Gene	Gp1ba	ENTREZGENE
PANTHER	IG(IMMUNOGLOBULIN) AND LRR(LEUCINE RICH REPEAT) DOMAINS	UniProtKB/TrEMBL
	PLATELET GLYCOPROTEIN IB ALPHA CHAIN-LIKE-RELATED	UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/TrEMBL
PhenoGen	Gp1ba	PhenoGen
PRINTS	LEURICHRPT	UniProtKB/TrEMBL
PROSITE	LRR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000025959	RatGTEx
SMART	LRR_BAC	UniProtKB/TrEMBL
	LRR_TYP	UniProtKB/TrEMBL
	LRRCT	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
UniProt	A0ABK0M4I1_RAT	UniProtKB/TrEMBL
	A6HG72	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQU7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-25	Gp1ba	glycoprotein Ib platelet subunit alpha	Gp1ba	glycoprotein Ib platelet alpha subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-20	Gp1ba	glycoprotein Ib platelet alpha subunit	Gp1ba	glycoprotein Ib (platelet), alpha polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Gp1ba	glycoprotein Ib (platelet), alpha polypeptide	Gp1ba	glycoprotein 1b, alpha polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Gp1ba	glycoprotein 1b, alpha polypeptide	LOC687719	similar to glycoprotein 1b, alpha polypeptide	Data merged from RGD:1597565	1643240	APPROVED
2008-04-30	Gp1ba	glycoprotein 1b, alpha polypeptide	Gp1ba_predicted	glycoprotein 1b, alpha polypeptide	'predicted' is removed	2292626	APPROVED
2007-04-18		glycoprotein 1b, alpha polypeptide	Gp1ba_predicted	glycoprotein 1b, alpha polypeptide (predicted)	Name updated	1299863	PROVISIONAL
2007-04-18	Gp1ba_predicted	glycoprotein 1b, alpha polypeptide (predicted)	LOC691992	similar to glycoprotein 1b, alpha polypeptide	Data merged from RGD:1593300	737654	PROVISIONAL
2006-11-20	LOC691992	similar to glycoprotein 1b, alpha polypeptide			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC687719	similar to glycoprotein 1b, alpha polypeptide			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Gp1ba_predicted	glycoprotein 1b, alpha polypeptide (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)