Advanced Search (OLGA)

Gene: Nectin3 (nectin cell adhesion molecule 3) Rattus norvegicus

Analyze

Symbol:

Nectin3

Name:

nectin cell adhesion molecule 3

RGD ID:

1309516

Description:

Predicted to enable cell adhesion mediator activity and protein homodimerization activity. Predicted to be involved in several processes, including cochlea morphogenesis; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules; and homophilic cell adhesion via plasma membrane adhesion molecules. Predicted to act upstream of or within several processes, including camera-type eye morphogenesis; fertilization; and protein localization to cell junction. Located in axon and dendrite. Orthologous to human NECTIN3 (nectin cell adhesion molecule 3); INTERACTS WITH 1,3-dinitrobenzene; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC288124; nectin-3; poliovirus receptor-related 3; poliovirus receptor-related protein 3; Pvrl3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NECTIN3 (nectin cell adhesion molecule 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Nectin3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nectin3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NECTIN3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NECTIN3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nectin3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NECTIN3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NECTIN3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nectin3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nectin3 (nectin cell adhesion molecule 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NECTIN3 (nectin cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nectin3 (nectin cell adhesion molecule 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nectin3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nectin3b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nectin3b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nectin3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nectin3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Fas3	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	67,825,296 - 67,931,999 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	67,827,137 - 67,871,383 (+)	Ensembl				GRCr8
mRatBN7.2	11	54,362,712 - 54,469,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	54,364,487 - 54,462,519 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	63,127,098 - 63,232,154 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	55,788,938 - 55,893,999 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	54,896,828 - 55,001,808 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	57,897,879 - 57,995,193 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	57,897,879 - 57,993,548 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	62,049,050 - 62,146,379 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	55,843,801 - 55,940,634 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	53,897,883 - 53,994,695 (+)	NCBI		Celera
RGSC_v3.1	11	55,901,379 - 55,946,114 (+)	NCBI
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract (ISO)

Teratozoospermia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

caffeine (ISO)

chloroprene (ISO)

choline (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (EXP)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dichloromethane (EXP)

dicrotophos (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

ethylbenzene (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

glafenine (EXP)

ketamine (EXP)

L-methionine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

niclosamide (ISO)

nimesulide (EXP)

ouabain (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (IEA,ISO)

cell-cell adhesion (ISO)

cochlea morphogenesis (IEA,ISO)

establishment of protein localization to plasma membrane (IEA,ISO)

fertilization (ISO)

heterophilic cell-cell adhesion (IEA,ISO)

homophilic cell-cell adhesion (IEA,ISO)

lens morphogenesis in camera-type eye (ISO)

protein localization to cell junction (ISO)

regulation of postsynapse assembly (IEA,ISO)

retina morphogenesis in camera-type eye (ISO)

symbiont entry into host cell (IEA)

Cellular Component

adherens junction (IEA,ISO)

apical junction complex (IEA,ISO)

axon (IDA)

cell-cell contact zone (IEA,ISO)

cell-cell junction (IEA,ISO)

dendrite (IDA)

hippocampal mossy fiber to CA3 synapse (IEA,ISO)

membrane (IEA)

plasma membrane (IEA,ISO)

postsynaptic density membrane (IEA,ISO)

Molecular Function

cell adhesion mediator activity (IEA,ISO)

cell adhesion molecule binding (IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Interneurite affinity is regulated by heterophilic nectin interactions in concert with the cadherin machinery.	Togashi H, etal., J Cell Biol. 2006 Jul 3;174(1):141-51. Epub 2006 Jun 26.

Additional References at PubMed

PMID:10744716	PMID:11827984	PMID:12438620	PMID:12515806	PMID:12740392	PMID:12759359	PMID:12826663	PMID:15328010	PMID:15660130	PMID:15728677	PMID:16249236	PMID:22512338
PMID:22902367	PMID:23073828	PMID:23533177	PMID:23990464	PMID:25232752	PMID:27044745	PMID:27217376	PMID:28176461

Genomics

Comparative Map Data

Nectin3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	67,825,296 - 67,931,999 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	67,827,137 - 67,871,383 (+)	Ensembl				GRCr8
mRatBN7.2	11	54,362,712 - 54,469,351 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	54,364,487 - 54,462,519 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	63,127,098 - 63,232,154 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	55,788,938 - 55,893,999 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	54,896,828 - 55,001,808 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	57,897,879 - 57,995,193 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	57,897,879 - 57,993,548 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	62,049,050 - 62,146,379 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	55,843,801 - 55,940,634 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	53,897,883 - 53,994,695 (+)	NCBI		Celera
RGSC_v3.1	11	55,901,379 - 55,946,114 (+)	NCBI
Cytogenetic Map	11	q21	NCBI

NECTIN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	111,071,816 - 111,194,170 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	111,070,071 - 111,275,563 (+)	Ensembl			hg38	GRCh38
GRCh37	3	110,790,663 - 110,913,017 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	112,273,555 - 112,335,752 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	112,273,554 - 112,335,752	NCBI
Celera	3	109,190,329 - 109,252,381 (+)	NCBI		Celera
Cytogenetic Map	3	q13.13	NCBI
HuRef	3	108,164,840 - 108,287,207 (+)	NCBI		HuRef
CHM1_1	3	110,754,866 - 110,877,275 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	113,792,242 - 113,914,605 (+)	NCBI		T2T-CHM13v2.0

Nectin3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	46,208,028 - 46,318,898 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	46,208,069 - 46,318,888 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	46,387,665 - 46,498,535 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	46,387,706 - 46,498,525 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	46,395,118 - 46,497,080 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	46,314,342 - 46,416,301 (-)	NCBI		MGSCv36	mm8
Celera	16	46,777,549 - 46,846,805 (-)	NCBI		Celera
Cytogenetic Map	16	B5	NCBI
cM Map	16	30.48	NCBI

Nectin3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	11,606,909 - 11,724,004 (+)	Ensembl
ChiLan1.0	NW_004955427	11,639,942 - 11,731,910 (+)	NCBI	ChiLan1.0	ChiLan1.0

NECTIN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	109,075,028 - 109,205,819 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	109,079,806 - 109,210,597 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	108,223,380 - 108,354,079 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	115,148,481 - 115,278,563 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	115,148,481 - 115,270,507 (+)	Ensembl			panPan2	panpan1.1

NECTIN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	15,868,813 - 16,173,158 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	15,911,411 - 15,933,307 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	15,973,728 - 16,274,980 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	16,032,718 - 16,154,568 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	33	15,919,132 - 16,220,406 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	15,972,140 - 16,266,709 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	16,516,552 - 16,812,105 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nectin3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	138,471,852 - 138,498,191 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936834	86,226 - 109,684 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936834	86,195 - 110,686 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NECTIN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	148,452,309 - 148,579,052 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	148,448,581 - 148,578,920 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	158,456,487 - 158,604,357 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NECTIN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	69,597,729 - 69,719,397 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	69,598,895 - 69,719,343 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	96,776,500 - 96,905,043 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nectin3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	37,433,809 - 37,568,677 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624731	37,425,966 - 37,567,938 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nectin3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	31,094,384 - 31,191,558 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nectin3
346 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	48
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000002957
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

BF386882

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,420,167 - 54,420,318 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,937,717 - 57,937,867	NCBI	Rnor6.0
Rnor_5.0	11	62,088,888 - 62,089,038	UniSTS	Rnor5.0
RGSC_v3.4	11	55,899,485 - 55,899,635	UniSTS	RGSC3.4
Celera	11	53,953,547 - 53,953,697	UniSTS
RH 3.4 Map	4	581.7	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH12011

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,408,037 - 54,408,162 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,949,873 - 57,949,997	NCBI	Rnor6.0
Rnor_5.0	11	62,101,044 - 62,101,168	UniSTS	Rnor5.0
RGSC_v3.4	11	55,887,352 - 55,887,476	UniSTS	RGSC3.4
Celera	11	53,941,436 - 53,941,560	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH133661

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,410,912 - 54,411,070 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,946,965 - 57,947,122	NCBI	Rnor6.0
Rnor_5.0	11	62,098,136 - 62,098,293	UniSTS	Rnor5.0
RGSC_v3.4	11	55,890,227 - 55,890,384	UniSTS	RGSC3.4
Celera	11	53,944,311 - 53,944,468	UniSTS
RH 3.4 Map	4	621.62	UniSTS
Cytogenetic Map	11	q21	UniSTS

BE111876

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,414,838 - 54,415,010 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,943,025 - 57,943,196	NCBI	Rnor6.0
Rnor_5.0	11	62,094,196 - 62,094,367	UniSTS	Rnor5.0
RGSC_v3.4	11	55,894,153 - 55,894,324	UniSTS	RGSC3.4
Celera	11	53,948,237 - 53,948,408	UniSTS
RH 3.4 Map	4	581.3	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH137470

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,409,388 - 54,409,595 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,948,440 - 57,948,646	NCBI	Rnor6.0
Rnor_5.0	11	62,099,611 - 62,099,817	UniSTS	Rnor5.0
RGSC_v3.4	11	55,888,703 - 55,888,909	UniSTS	RGSC3.4
Celera	11	53,942,787 - 53,942,993	UniSTS
Cytogenetic Map	11	q21	UniSTS

PVRL3__5617

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	54,407,959 - 54,408,539 (-)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,949,496 - 57,950,075	NCBI	Rnor6.0
Rnor_5.0	11	62,100,667 - 62,101,246	UniSTS	Rnor5.0
RGSC_v3.4	11	55,887,274 - 55,887,853	UniSTS	RGSC3.4
Celera	11	53,941,358 - 53,941,937	UniSTS
Cytogenetic Map	11	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	69	59	6	333	169	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006248338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270399	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270404	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001840409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001840410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_358269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002957 ⟹ ENSRNOP00000002957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	67,827,137 - 67,871,383 (+)	Ensembl
mRatBN7.2 Ensembl	11	54,364,487 - 54,420,390 (+)	Ensembl
Rnor_6.0 Ensembl	11	57,897,879 - 57,993,548 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102870 ⟹ ENSRNOP00000096764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	54,364,487 - 54,462,519 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115289 ⟹ ENSRNOP00000082293

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	54,364,487 - 54,410,018 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119871 ⟹ ENSRNOP00000089435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	54,408,640 - 54,461,316 (+)	Ensembl

RefSeq Acc Id:

NM_001105883 ⟹ NP_001099353

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,826,944 - 67,931,999 (+)	NCBI
mRatBN7.2	11	54,364,296 - 54,469,351 (+)	NCBI
Rnor_6.0	11	57,897,879 - 57,993,548 (-)	NCBI
Rnor_5.0	11	62,049,050 - 62,146,379 (-)	NCBI
RGSC_v3.4	11	55,843,801 - 55,940,634 (+)	RGD
Celera	11	53,897,883 - 53,994,695 (+)	RGD

Sequence:

show sequence

GCAAGGCGGGCATGGCGCGGACCCCGGGCCCGGCCCTGTTGTGTCCTGGAGGCGGCAAAGCACA
ACTTTCCTCGGCGTCTCCTCCCGCGGCCGGACTCCTGCTGCCGGCCCCGACGCCGCCGCCGCTG
CTGCTGCTGCTCATTCCCCTGCTTCTCTTCTCCCGGCTCTGTGGTGCCTTAGCTGGATCAATTA
TTGTGGAGCCGCATGTCACAGCAGTGTGGGGAAAGAATGTGTCCTTGAAGTGTTTAATTGAAGT
GAATGAGACTATCACACAGATCTCATGGGAGAAGATACACGGCAAGAGCACACAGACCGTTGCG
GTGCATCATCCTCAGTATGGATTCTCTGTTCAGGGAGAGTATCAGGGAAGAATCTTGTTTAAAA
ACTATTCACTTAATGATGCAACAATTACTCTGCATAACATAGGCTTCTCAGATTCTGGAAAATA
CATATGCAAAGCTGTCACATTCCCACTTGGAAATGCCCAGTCCTCTACAACTGTGACTGTGCTA
GTTGAACCCACCGTGAGCCTGATGAAAGGGCCAGACTCTTTAATTGATGGAGGAAATGAGACCG
TAGCAGCCGTTTGTATAGCGGCCACTGGAAAACCAGTTGCACGTATTGACTGGGAAGGGGATCT
CGGCGAAATGGAATCTACTATAACTTCTTTTCCCAATGAAACAGCAACGATTATCAGCCAATAC
AAGCTGTTTCCCACAAGATTTGCTAGAGGAAGGCGAATTACTTGTGTTGTAAAACATCCAGCCT
TAGAAAAGGACATTCGATACTCTTTCATACTCGACATCCAGTATGCTCCTGAAGTCTCAGTGAC
AGGATATGATGGAAATTGGTTTGTGGGAAGAAAAGGTGTTAACCTCAAGTGTAATGCTGACGCA
AATCCTCCACCCTTCAAGTCTGTGTGGAGCAGGTTGGATGGAGAATGGCCTGATGGTTTATTGG
CGTCAGACAATACTCTTCATTTTGTTCATCCACTGACTTTCAATTATTCTGGTGTTTATGTCTG
TAAAGTGACAAATTCCCTTGGTCAAAGAAGTGATCAAAAGGTCATCTACATTTCAGACATCCCG
CTTAAGCAGACCTCATCCATAGCAGTGGCTGGAGCTGTGATTGGAGCTGTCCTGGCCCTCTTCA
TCATCGCTGTCTTTGTGACTGTGTTGCTGACACCTCGGAAAAAGAGACCATCCTATCTTGACAA
AGTAATCGACCTTCCACCTACACATAAGCCACCCCCTGTATATGAAGAACGAATTCCTTCTCTC
CCTCAGAAAAACCGTCTGTTCCAGACTGAACGCTTGCCTTTGCAGACTCAGTTCAAAGAGAAAG
GAGCTGGTGGTCTTCAGCCCCCTAATGGACCAATTAGGAGACTTGACTATGAGGATGAGAACAC
AGTGCAAGAAGATGGGACTCAGCAGATGTGCCCCCTTTATAACCAGATGTGCCACCAAGACCGA
AGCCCTCACCAACATCGCCCACGCAACCCCGAGAGACTCTACATCAACCCAAGAGAACATTATG
TGTGATTTTCCTCATTATAAAGGGTGTTCTAACCAATGCCTATTAGACCTGAGAGAGAAACTGA
GGCATCTAAACGATTTTAGTCTTAAGGGTG

hide sequence

RefSeq Acc Id:

NM_001399228 ⟹ NP_001386157

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,826,944 - 67,876,731 (+)	NCBI
mRatBN7.2	11	54,364,296 - 54,414,083 (+)	NCBI

RefSeq Acc Id:

XM_039088189 ⟹ XP_038944117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,300 - 67,871,452 (+)	NCBI
mRatBN7.2	11	54,362,712 - 54,413,560 (+)	NCBI

RefSeq Acc Id:

XM_063270397 ⟹ XP_063126467

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,300 - 67,881,282 (+)	NCBI

RefSeq Acc Id:

XM_063270398 ⟹ XP_063126468

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,300 - 67,881,282 (+)	NCBI

RefSeq Acc Id:

XM_063270399 ⟹ XP_063126469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,300 - 67,931,228 (+)	NCBI

RefSeq Acc Id:

XM_063270400 ⟹ XP_063126470

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,300 - 67,931,228 (+)	NCBI

RefSeq Acc Id:

XM_063270401 ⟹ XP_063126471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,296 - 67,871,452 (+)	NCBI

RefSeq Acc Id:

XM_063270402 ⟹ XP_063126472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,826,920 - 67,881,282 (+)	NCBI

RefSeq Acc Id:

XM_063270403 ⟹ XP_063126473

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,848,089 - 67,871,452 (+)	NCBI

RefSeq Acc Id:

XM_063270404 ⟹ XP_063126474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,825,331 - 67,883,033 (+)	NCBI

RefSeq Acc Id:

XM_063270405 ⟹ XP_063126475

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	67,827,476 - 67,871,452 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099353	(Get FASTA)	NCBI Sequence Viewer
	NP_001386157	(Get FASTA)	NCBI Sequence Viewer
	XP_038944117	(Get FASTA)	NCBI Sequence Viewer
	XP_063126467	(Get FASTA)	NCBI Sequence Viewer
	XP_063126468	(Get FASTA)	NCBI Sequence Viewer
	XP_063126469	(Get FASTA)	NCBI Sequence Viewer
	XP_063126470	(Get FASTA)	NCBI Sequence Viewer
	XP_063126471	(Get FASTA)	NCBI Sequence Viewer
	XP_063126472	(Get FASTA)	NCBI Sequence Viewer
	XP_063126473	(Get FASTA)	NCBI Sequence Viewer
	XP_063126474	(Get FASTA)	NCBI Sequence Viewer
	XP_063126475	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11119	(Get FASTA)	NCBI Sequence Viewer
	EDM11121	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002957
	ENSRNOP00000002957.7
	ENSRNOP00000089435.1

RefSeq Acc Id:	NP_001099353 ⟸ NM_001105883
- Peptide Label:	isoform 2
- UniProtKB:	A6IQW6 (UniProtKB/TrEMBL), A0A8I6APZ5 (UniProtKB/TrEMBL), A6IQW7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARTPGPALLCPGGGKAQLSSASPPAAGLLLPAPTPPPLLLLLIPLLLFSRLCGALAGSIIVEP HVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGEYQGRILFKNYSL NDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLMKGPDSLIDGGNETVAAV CIAATGKPVARIDWEGDLGEMESTITSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKD IRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGEWPDGLLASDN TLHFVHPLTFNYSGVYVCKVTNSLGQRSDQKVIYISDIPLKQTSSIAVAGAVIGAVLALFIIAV FVTVLLTPRKKRPSYLDKVIDLPPTHKPPPVYEERIPSLPQKNRLFQTERLPLQTQFKEKGAGG LQPPNGPIRRLDYEDENTVQEDGTQQMCPLYNQMCHQDRSPHQHRPRNPERLYINPREHYV hide sequence

Ensembl Acc Id:

ENSRNOP00000002957 ⟸ ENSRNOT00000002957

RefSeq Acc Id:	XP_038944117 ⟸ XM_039088189
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000082293 ⟸ ENSRNOT00000115289

Ensembl Acc Id:

ENSRNOP00000089435 ⟸ ENSRNOT00000119871

Ensembl Acc Id:

ENSRNOP00000096764 ⟸ ENSRNOT00000102870

RefSeq Acc Id:	NP_001386157 ⟸ NM_001399228
- Peptide Label:	isoform 1
- UniProtKB:	A0A8I5ZU75 (UniProtKB/TrEMBL), A6IQW8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126471 ⟸ XM_063270401
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063126470 ⟸ XM_063270400
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063126469 ⟸ XM_063270399
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063126467 ⟸ XM_063270397
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063126468 ⟸ XM_063270398
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063126474 ⟸ XM_063270404
- Peptide Label:	isoform X9
- UniProtKB:	A0A8I6APZ5 (UniProtKB/TrEMBL), A6IQW7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126472 ⟸ XM_063270402
- Peptide Label:	isoform X7
- UniProtKB:	D4A5C0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126475 ⟸ XM_063270405
- Peptide Label:	isoform X10

RefSeq Acc Id:	XP_063126473 ⟸ XM_063270403
- Peptide Label:	isoform X8

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5C0-F1-model_v2	AlphaFold	D4A5C0	1-509	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309516	AgrOrtholog
BioCyc Gene	G2FUF-21398	BioCyc
Ensembl Genes	ENSRNOG00000002176	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000091129	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002957	ENTREZGENE
	ENSRNOT00000002957.7	UniProtKB/TrEMBL
	ENSRNOT00000119871.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	CD80_C2-set	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
	IgC1_2_Nectin-3-4-like	UniProtKB/TrEMBL
	Nectin-3	UniProtKB/TrEMBL
	Nectin/Nectin-like	UniProtKB/TrEMBL
KEGG Report	rno:288124	UniProtKB/TrEMBL
NCBI Gene	288124	ENTREZGENE
PANTHER	NECTIN-RELATED	UniProtKB/TrEMBL
	PTHR23277:SF12	UniProtKB/TrEMBL
Pfam	C2-set_2	UniProtKB/TrEMBL
	V-set	UniProtKB/TrEMBL
PhenoGen	Nectin3	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002176	RatGTEx
	ENSRNOG00000091129	RatGTEx
SMART	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A0A8I5ZU75	ENTREZGENE
	A0A8I6ABQ5_RAT	UniProtKB/TrEMBL
	A0A8I6APZ5	ENTREZGENE
	A6IQW6	ENTREZGENE, UniProtKB/TrEMBL
	A6IQW7	ENTREZGENE, UniProtKB/TrEMBL
	A6IQW8	ENTREZGENE, UniProtKB/TrEMBL
	D4A5C0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Nectin3	nectin cell adhesion molecule 3	Pvrl3	poliovirus receptor-related 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Pvrl3	poliovirus receptor-related 3	Pvrl3_predicted	poliovirus receptor-related 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pvrl3_predicted	poliovirus receptor-related 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD