Advanced Search (OLGA)

Gene: Ccnl2 (cyclin L2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ccnl2

Name:

cyclin L2

RGD ID:

1309149

Description:

Predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity. Predicted to be involved in regulation of RNA splicing. Predicted to be located in nucleoplasm. Predicted to be part of cyclin-dependent protein kinase holoenzyme complex. Predicted to be active in nucleus. Orthologous to human CCNL2 (cyclin L2); INTERACTS WITH 17beta-estradiol; 4,4'-diaminodiphenylmethane; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cyclin-L2; LOC298686

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCNL2 (cyclin L2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccnl2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccnl2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCNL2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCNL2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccnl2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCNL2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103225798 (cyclin-L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccnl2 (cyclin L2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AURKAIP1 (aurora kinase A interacting protein 1)	HGNC	EggNOG, Inparanoid, OrthoDB, PhylomeDB, Treefam
Alliance orthologs ³
Homo sapiens (human):	CCNL2 (cyclin L2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccnl2 (cyclin L2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccnl1b (cyclin L1b)	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG16903	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyl-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccnl2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,698,951 - 171,711,037 (+)	NCBI		GRCr8
mRatBN7.2	5	166,416,940 - 166,428,997 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,417,508 - 166,436,882 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,122,392 - 169,133,662 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	170,943,811 - 170,955,083 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	170,906,342 - 170,917,614 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,256,301 - 173,268,279 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,256,637 - 173,276,169 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,731,925 - 176,743,703 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,666,512 - 172,673,024 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,677,006 - 172,683,515 (+)	NCBI
Celera	5	164,618,287 - 164,624,788 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccnl2	Rat	chromosome 1p36 deletion syndrome		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar	PMID:25741868
Ccnl2	Rat	congenital myasthenic syndrome 8		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital myasthenic syndrome 8	ClinVar	PMID:24951643 and PMID:28492532
Ccnl2	Rat	dilated cardiomyopathy 1LL		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Left ventricular noncompaction 8	ClinVar	PMID:28492532
Ccnl2	Rat	Ehlers-Danlos syndrome spondylodysplastic type 2		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome more ...	ClinVar	PMID:10862081 more ...
Ccnl2	Rat	Goldberg-Shprintzen syndrome		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Shprintzen-Goldberg syndrome	ClinVar	PMID:23892090 more ...
Ccnl2	Rat	Idiopathic Generalized Epilepsy		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Ccnl2	Rat	immunodeficiency 16		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Combined immunodeficiency due to OX40 deficiency	ClinVar	PMID:10862081 more ...
Ccnl2	Rat	immunodeficiency 38		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mendelian susceptibility to mycobacterial diseases due to complete ISG15 deficiency	ClinVar	PMID:10862081 more ...
Ccnl2	Rat	Joubert syndrome 25		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 25	ClinVar	PMID:10862081 more ...
Ccnl2	Rat	Neurodevelopmental Disorders		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Ccnl2	Rat	Peroxisome Biogenesis Disorder, Complementation Group 7		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peroxisome biogenesis disorder and complementation group 7	ClinVar	PMID:10862081 more ...
Ccnl2	Rat	Shprintzen-Goldberg Craniosynostosis		ISO	CCNL2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Shprintzen-Goldberg syndrome	ClinVar	PMID:23892090 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccnl2	Rat	(S)-nicotine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Ccnl2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CCNL2 mRNA	CTD	PMID:22206623
Ccnl2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of CCNL2 mRNA]	CTD	PMID:22206623
Ccnl2	Rat	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Ccnl2	Rat	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Ccnl2	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of CCNL2 mRNA	CTD	PMID:35192832
Ccnl2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ccnl2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CCNL2 mRNA	CTD	PMID:20702594
Ccnl2	Rat	2,3,7,8-Tetrachlorodibenzofuran	affects expression	ISO	Ccnl2 (Mus musculus)	6480464	2 more ...	CTD	PMID:20702594
Ccnl2	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CCNL2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CCNL2 mRNA	CTD	PMID:28628672
Ccnl2	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of CCNL2 mRNA	CTD	PMID:18648102
Ccnl2	Rat	4,4'-diaminodiphenylmethane	decreases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of CCNL2 mRNA	CTD	PMID:30723492
Ccnl2	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CCNL2 mRNA	CTD	PMID:28628672
Ccnl2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CCNL2 mRNA	CTD	PMID:30047161
Ccnl2	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of CCNL2 mRNA	CTD	PMID:31881176
Ccnl2	Rat	aflatoxin B1	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of CCNL2 mRNA	CTD	PMID:19770486
Ccnl2	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	CCNL2 (Homo sapiens)	6480464	aflatoxin B2 results in decreased methylation of CCNL2 polyA tail	CTD	PMID:30157460
Ccnl2	Rat	arsane	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CCNL2 mRNA	CTD	PMID:39836092
Ccnl2	Rat	arsenic atom	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CCNL2 mRNA	CTD	PMID:39836092
Ccnl2	Rat	benzo[b]fluoranthene	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	benzo(b)fluoranthene results in increased expression of CCNL2 mRNA	CTD	PMID:26377693
Ccnl2	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CCNL2 mRNA	CTD	PMID:25181051
Ccnl2	Rat	bisphenol A	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	bisphenol A results in decreased expression of CCNL2 mRNA	CTD	PMID:32156529
Ccnl2	Rat	bisphenol A	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of CCNL2 gene	CTD	PMID:31601247
Ccnl2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CCNL2 mRNA	CTD	PMID:34947998
Ccnl2	Rat	bisphenol A	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	bisphenol A results in increased expression of CCNL2 mRNA	CTD	PMID:33221593
Ccnl2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CCNL2 mRNA	CTD	PMID:30816183 more ...
Ccnl2	Rat	bisphenol A	affects expression	ISO	CCNL2 (Homo sapiens)	6480464	bisphenol A affects the expression of CCNL2 mRNA	CTD	PMID:30903817
Ccnl2	Rat	bisphenol F	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CCNL2 mRNA	CTD	PMID:28628672
Ccnl2	Rat	bisphenol F	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	bisphenol F results in decreased expression of CCNL2 mRNA	CTD	PMID:38685157
Ccnl2	Rat	butanal	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of CCNL2 mRNA	CTD	PMID:26079696
Ccnl2	Rat	cadmium dichloride	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of CCNL2 mRNA	CTD	PMID:38568856
Ccnl2	Rat	caffeine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Ccnl2	Rat	carbon nanotube	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
Ccnl2	Rat	CGP 52608	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to CCNL2 gene]	CTD	PMID:28238834
Ccnl2	Rat	choline	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CCNL2 gene	CTD	PMID:20938992
Ccnl2	Rat	chrysene	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	chrysene results in increased expression of CCNL2 mRNA	CTD	PMID:26377693
Ccnl2	Rat	ciguatoxin CTX1B	affects expression	ISO	Ccnl2 (Mus musculus)	6480464	Ciguatoxins affects the expression of CCNL2 mRNA	CTD	PMID:18353800
Ccnl2	Rat	copper atom	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of CCNL2 mRNA	CTD	PMID:20971185
Ccnl2	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of CCNL2 mRNA	CTD	PMID:30556269
Ccnl2	Rat	copper(0)	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of CCNL2 mRNA	CTD	PMID:20971185
Ccnl2	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of CCNL2 mRNA	CTD	PMID:30556269
Ccnl2	Rat	copper(II) sulfate	increases expression	ISO	CCNL2 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of CCNL2 mRNA	CTD	PMID:19549813
Ccnl2	Rat	crocidolite asbestos	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of CCNL2 mRNA	CTD	PMID:29279043
Ccnl2	Rat	cyclosporin A	increases expression	ISO	CCNL2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of CCNL2 mRNA	CTD	PMID:22147139
Ccnl2	Rat	dexamethasone	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CCNL2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CCNL2 mRNA	CTD	PMID:28628672
Ccnl2	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of CCNL2 mRNA	CTD	PMID:24893172
Ccnl2	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of CCNL2 mRNA	CTD	PMID:21551480
Ccnl2	Rat	doxorubicin	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	Doxorubicin results in increased expression of CCNL2 mRNA	CTD	PMID:25896364
Ccnl2	Rat	enniatin	increases expression	EXP		6480464	enniatins results in increased expression of CCNL2 mRNA	CTD	PMID:27163883
Ccnl2	Rat	folic acid	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CCNL2 gene more ...	CTD	PMID:20938992 and PMID:22206623
Ccnl2	Rat	FR900359	increases phosphorylation	ISO	CCNL2 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of CCNL2 protein	CTD	PMID:37730182
Ccnl2	Rat	fulvestrant	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of CCNL2 gene	CTD	PMID:31601247
Ccnl2	Rat	indometacin	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CCNL2 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CCNL2 mRNA	CTD	PMID:28628672
Ccnl2	Rat	L-methionine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CCNL2 gene	CTD	PMID:20938992
Ccnl2	Rat	lead diacetate	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	lead acetate results in decreased expression of CCNL2 mRNA	CTD	PMID:38568856
Ccnl2	Rat	leflunomide	increases expression	EXP		6480464	leflunomide results in increased expression of CCNL2 mRNA	CTD	PMID:24136188
Ccnl2	Rat	lipopolysaccharide	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	Plant Extracts affects the reaction [Lipopolysaccharides affects the expression of CCNL2 mRNA]	CTD	PMID:28070326
Ccnl2	Rat	lipopolysaccharide	affects expression	ISO	CCNL2 (Homo sapiens)	6480464	Lipopolysaccharides affects the expression of CCNL2 mRNA	CTD	PMID:28070326
Ccnl2	Rat	methamphetamine	increases expression	ISO	Ccnl2 (Mus musculus)	6480464	Methamphetamine results in increased expression of CCNL2 mRNA	CTD	PMID:26307267
Ccnl2	Rat	methapyrilene	increases expression	EXP		6480464	Methapyrilene results in increased expression of CCNL2 mRNA	CTD	PMID:22484513
Ccnl2	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of CCNL2 mRNA	CTD	PMID:30047161
Ccnl2	Rat	miconazole	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	Miconazole results in decreased expression of CCNL2 mRNA	CTD	PMID:27462272
Ccnl2	Rat	nefazodone	decreases expression	EXP		6480464	nefazodone results in decreased expression of CCNL2 mRNA	CTD	PMID:24136188
Ccnl2	Rat	nicotine	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Ccnl2	Rat	ozone	multiple interactions	ISO	Ccnl2 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CCNL2 mRNA	CTD	PMID:34911549
Ccnl2	Rat	paracetamol	affects expression	ISO	Ccnl2 (Mus musculus)	6480464	Acetaminophen affects the expression of CCNL2 mRNA	CTD	PMID:17562736
Ccnl2	Rat	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of CCNL2 mRNA	CTD	PMID:22484513
Ccnl2	Rat	pirinixic acid	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	pirinixic acid results in decreased expression of CCNL2 mRNA	CTD	PMID:18445702
Ccnl2	Rat	potassium dichromate	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	Potassium Dichromate results in decreased expression of CCNL2 mRNA	CTD	PMID:23608068
Ccnl2	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of CCNL2 mRNA	CTD	PMID:30047161
Ccnl2	Rat	propiconazole	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	propiconazole results in decreased expression of CCNL2 mRNA	CTD	PMID:21278054
Ccnl2	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of CCNL2 mRNA	CTD	PMID:28374803
Ccnl2	Rat	sodium arsenite	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of CCNL2 mRNA	CTD	PMID:34032870
Ccnl2	Rat	sodium arsenite	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CCNL2 mRNA and sodium arsenite promotes the reaction [CCNL2 protein binds to CAPRIN1 protein]	CTD	PMID:33939924 and PMID:39836092
Ccnl2	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of CCNL2 mRNA	CTD	PMID:30047161
Ccnl2	Rat	testosterone	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	Testosterone results in decreased expression of CCNL2 mRNA	CTD	PMID:21669218
Ccnl2	Rat	tetraphene	affects expression	ISO	Ccnl2 (Mus musculus)	6480464	benz(a)anthracene affects the expression of CCNL2 mRNA	CTD	PMID:26377693
Ccnl2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of CCNL2 mRNA	CTD	PMID:22659510 and PMID:23411599
Ccnl2	Rat	thiram	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	Thiram results in decreased expression of CCNL2 mRNA	CTD	PMID:38568856
Ccnl2	Rat	titanium dioxide	decreases methylation	ISO	Ccnl2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of CCNL2 gene	CTD	PMID:35295148
Ccnl2	Rat	tolcapone	increases expression	EXP		6480464	tolcapone results in increased expression of CCNL2 mRNA	CTD	PMID:24136188
Ccnl2	Rat	triphenyl phosphate	affects expression	ISO	CCNL2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CCNL2 mRNA	CTD	PMID:37042841
Ccnl2	Rat	valproic acid	decreases expression	ISO	CCNL2 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of CCNL2 mRNA	CTD	PMID:29154799
Ccnl2	Rat	valproic acid	affects expression	ISO	CCNL2 (Homo sapiens)	6480464	Valproic Acid affects the expression of CCNL2 mRNA	CTD	PMID:25979313
Ccnl2	Rat	valproic acid	decreases expression	ISO	Ccnl2 (Mus musculus)	6480464	Valproic Acid results in decreased expression of CCNL2 mRNA	CTD	PMID:19136453
Ccnl2	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of CCNL2 mRNA	CTD	PMID:23034163
Ccnl2	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of CCNL2 mRNA	CTD	PMID:23034163
Ccnl2	Rat	zidovudine	multiple interactions	ISO	CCNL2 (Homo sapiens)	6480464	[Zidovudine co-treated with IFNA1 protein] results in increased expression of CCNL2 mRNA	CTD	PMID:20370541

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccnl2	Rat	regulation of RNA splicing	involved_in	ISO	CCNL2 (Homo sapiens)	1624291	PMID:18216018	RGD	PMID:18216018
Ccnl2	Rat	regulation of RNA splicing	involved_in	IEA	UniProtKB:Q96S94 and ensembl:ENSP00000383611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccnl2	Rat	regulation of transcription by RNA polymerase II	involved_in	IEA	InterPro:IPR043198	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccnl2	Rat	cyclin-dependent protein kinase holoenzyme complex	part_of	ISO	CCNL2 (Homo sapiens)	1624291	PMID:18216018	RGD	PMID:18216018
Ccnl2	Rat	cyclin-dependent protein kinase holoenzyme complex	part_of	IEA	UniProtKB:Q96S94 and ensembl:ENSP00000383611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccnl2	Rat	intracellular membrane-bounded organelle	located_in	ISO	CCNL2 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Ccnl2	Rat	intracellular membrane-bounded organelle	located_in	IEA	UniProtKB:Q96S94 and ensembl:ENSP00000383611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccnl2	Rat	nuclear speck	located_in	IEA	UniProtKB-SubCell:SL-0186	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ccnl2	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q96S94 and ensembl:ENSP00000383611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccnl2	Rat	nucleoplasm	located_in	IEA	UniProtKB-SubCell:SL-0190	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ccnl2	Rat	nucleoplasm	located_in	ISO	CCNL2 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Ccnl2	Rat	nucleus	located_in	ISO	CCNL2 (Homo sapiens)	1624291	PMID:17494991	RGD	PMID:17494991
Ccnl2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ccnl2	Rat	nucleus	located_in	IEA	UniProtKB:Q96S94 and ensembl:ENSP00000383611	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccnl2	Rat	nucleus	is_active_in	IBA	FB:FBgn0004597 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ccnl2	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccnl2	Rat	cyclin-dependent protein serine/threonine kinase regulator activity	enables	IEA	InterPro:IPR043198	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ccnl2	Rat	cyclin-dependent protein serine/threonine kinase regulator activity	enables	IBA	FB:FBgn0004597 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ccnl2	Rat	protein binding	enables	ISO	CCNL2 (Homo sapiens) and UniProtKB:Q96S94-5	1624291	UniProtKB:O15156-2 more ...	RGD	PMID:32296183
Ccnl2	Rat	protein binding	enables	ISO	Ccnl2 (Mus musculus)	1624291	UniProtKB:Q69ZA1 and PMID:17261272	RGD	PMID:17261272
Ccnl2	Rat	protein binding	enables	ISO	CCNL2 (Homo sapiens)	1624291	UniProtKB:Q59EK9 and PMID:25416956	RGD	PMID:25416956
Ccnl2	Rat	protein binding	enables	IPI	UniProtKB:Q3MJK5	8553775	PMID:16537916	UniProt

#	Reference Title	Reference Citation
1.	Identification and characterization of the CDK12/cyclin L1 complex involved in alternative splicing regulation.	Chen HH, etal., Mol Cell Biol. 2006 Apr;26(7):2736-45.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:15057822	PMID:15489334	PMID:17494991

Ccnl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,698,951 - 171,711,037 (+)	NCBI		GRCr8
mRatBN7.2	5	166,416,940 - 166,428,997 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,417,508 - 166,436,882 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,122,392 - 169,133,662 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	170,943,811 - 170,955,083 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	170,906,342 - 170,917,614 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,256,301 - 173,268,279 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,256,637 - 173,276,169 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,731,925 - 176,743,703 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,666,512 - 172,673,024 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	172,677,006 - 172,683,515 (+)	NCBI
Celera	5	164,618,287 - 164,624,788 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

CCNL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	1,385,711 - 1,399,335 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	1,385,711 - 1,399,335 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	1,321,091 - 1,334,715 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	1,310,954 - 1,324,553 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	1,246,539 - 1,260,165 (+)	NCBI		Celera
Cytogenetic Map	1	p36.33	NCBI
HuRef	1	593,397 - 606,925 (-)	NCBI		HuRef
CHM1_1	1	1,308,113 - 1,322,132 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	817,645 - 832,544 (-)	NCBI		T2T-CHM13v2.0

Ccnl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	155,894,468 - 155,909,005 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	155,896,946 - 155,909,000 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	155,810,219 - 155,824,543 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	155,812,489 - 155,824,543 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	155,186,598 - 155,198,652 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	154,656,289 - 154,668,343 (+)	NCBI		MGSCv36	mm8
Celera	4	158,083,766 - 158,095,796 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	87.47	NCBI

Ccnl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	9,423,491 - 9,432,811 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	9,423,491 - 9,432,811 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCNL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	226,826,053 - 226,839,037 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	225,523,620 - 225,536,617 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	142,530 - 155,377 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	1,343,608 - 1,355,392 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	1,344,346 - 1,355,361 (-)	Ensembl	panpan1.1		panPan2

CCNL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	56,542,358 - 56,550,701 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	56,542,566 - 56,550,691 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	56,618,538 - 56,626,881 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	56,744,445 - 56,752,791 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	56,744,452 - 56,752,793 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	56,735,164 - 56,743,507 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	56,627,430 - 56,635,773 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	57,017,713 - 57,026,057 (-)	NCBI		UU_Cfam_GSD_1.0

Ccnl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	27,692,794 - 27,700,958 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936737	1,764,189 - 1,772,475 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936737	1,765,027 - 1,773,156 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCNL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,659,054 - 63,668,047 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	63,659,053 - 63,668,077 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	58,269,483 - 58,271,859 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103225798
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	130,049,590 - 130,065,241 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	130,049,646 - 130,065,881 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	34,588,417 - 34,603,111 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccnl2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	8,233,574 - 8,242,542 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	8,233,547 - 8,242,547 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ccnl2
49 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	71
Interacting mature miRNAs:	84
Transcripts:	ENSRNOT00000025531
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat

RH144311

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,422,663 - 166,422,796 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,261,946 - 173,262,078	NCBI	Rnor6.0
Rnor_5.0	5	176,737,560 - 176,737,692	UniSTS	Rnor5.0
RGSC_v3.4	5	172,671,627 - 172,671,759	UniSTS	RGSC3.4
Celera	5	164,623,391 - 164,623,523	UniSTS
RH 3.4 Map	5	1164.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

AA955673

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	171,703,000 - 171,703,135 (+)	Marker Load Pipeline
mRatBN7.2	5	166,420,765 - 166,420,900 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,260,048 - 173,260,182	NCBI	Rnor6.0
Rnor_5.0	5	176,735,662 - 176,735,796	UniSTS	Rnor5.0
RGSC_v3.4	5	172,669,727 - 172,669,861	UniSTS	RGSC3.4
Celera	5	164,621,493 - 164,621,627	UniSTS
RH 3.4 Map	5	1175.1	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001401305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005504417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_592798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025531 ⟹ ENSRNOP00000025531

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,417,508 - 166,435,860 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,256,637 - 173,275,340 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000025952 ⟹ ENSRNOP00000025952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,435,194 - 166,436,882 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,274,774 - 173,276,169 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089936 ⟹ ENSRNOP00000068952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,417,540 - 166,428,800 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,256,834 - 173,263,334 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096422 ⟹ ENSRNOP00000077305

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,417,550 - 166,428,797 (+)	Ensembl

RefSeq Acc Id:

NM_001401305 ⟹ NP_001388234

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,699,775 - 171,711,037 (+)	NCBI
mRatBN7.2	5	166,417,540 - 166,428,802 (+)	NCBI

RefSeq Acc Id:

NM_001401307 ⟹ NP_001388236

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,699,775 - 171,707,417 (+)	NCBI
mRatBN7.2	5	166,417,540 - 166,425,182 (+)	NCBI

RefSeq Acc Id:

XM_006239544 ⟹ XP_006239606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,698,951 - 171,711,035 (+)	NCBI
mRatBN7.2	5	166,416,954 - 166,428,997 (+)	NCBI
Rnor_6.0	5	173,256,306 - 173,268,279 (+)	NCBI
Rnor_5.0	5	176,731,925 - 176,743,703 (+)	NCBI

Sequence:

show sequence

GAGGTCCGCCTGCTTCTGCCTTCCAAGTGCTGGGATTAAAGGCACCACTGCCCCGCTTTCTTCTGCACCTTTAATGCTGGCAGATCCACCCCACAGCCAGAGGACAGAAGAGGGTTGCGAACTAAAGA
CCCTGAACTAAATCGCGGTGTAATGTACACATGAGACTGTGGAGAAAAAGGGTTGTTCTGTCCCGATCCCCGCGGAAAGACTCCCTTCTAGAACCCCAGTTTTCGAGGCAGAAGCACTGTAACCTCCG
GATTTCGAGACAGTAGCCTTGTAATCTCCTGGCTTTCTGGATTGACCACTTCCGGTTCGGGCCAGGCCGCGGAGCCAAGTGGGTAACGAGCAGCCCCACCCGTGGGTACTTCCGGCGTCAGTGCCTGA
CGCGATACTGAAGGACTGGTCGTACGGCCAACGGCGTCGAGACAGCGGTGACGTTCAACCAATGGAAGGGGGTGGGGCGGGGCGGCCATGATCGTCTCGAGCAGCCGCCCTGACGGGAAGGGCCCGAA
AAGAGTCGGCGGCACAAAATGGCGGCGGCGGCAGCCGGGGCTTCGGGGTTGATGGCTCCTGCGTTGGCGGCCTGCTCTTCCGGCTCGGGGGGAGCAGCCCCAGGGTCTCAGGGGGTGCTGATCGGTGA
CAGGCTATACTCCGGAGTTCTCATCACCTTGGAAAACTGCCTGCTGCCCGACGACAAGCTCCGCTTCACGCCATCCATGTCGAGCGGTCTCGACATCGATACAGAGACTGGACTCCGCGTAGTGGGCT
GCGAGCTCATCCAGGCAGCCGGCATCCTACTCCGCCTGCCGCAGGTGGCCATGGCTACAGGGCAGGTGTTGTTCCAGCGCTTCTTTTACACTAAGTCCTTCGTGAAACATTCCATGGAGCATGTGTCC
ATGGCTTGTGTTCACCTGGCTTCCAAAATAGAAGAGGCTCCAAGACGAATCAGAGATGTCATCAACGTATTCCATCGCCTTCGGCATCTGCGAGAGAAAAAGAAACCTGTGCCTCTGGTGCTGGATCA
AGAGTATGTTAATCTGAAGAACCAGATTATAAAGGCAGAGAGACGGGTTCTCAAGGAATTGGGCTTTTGTGTCCATGTGAAGCATCCTCACAAGATAATCGTTATGTACCTTCAGGTGTTAGAATGTG
AGCGTAATCAGCACCTGGTCCAGACTGCATGGAACTACATGAATGACAGCCTTCGCACAGATGTCTTTGTGCGGTTCCAGCCTGAAAGCATTGCTTGTGCCTGTATCTACCTTGCTGCCCGGACACTG
GAGATCCCTTTACCTAATCGTCCACATTGGTTTCTTTTGTTTGGAGCAACTGAAGAGGAAATTCAAGAAATTTGCTTTAAAATCTTGCAGCTTTATACACGGAAAAAGGTTGACTTGACGCATCTGGA
AAGTGAAGTGGAAAAGAGAAAGCACGCCATCGAAGAGGCAAAGGCACGAGCCAAGGGTCTGCTGCCACCAGGGAGTGCGCCAGGCTTGGACAGTGCTACTGCAGGGTTCTCACCCGCTCCCAAGCCGG
TAGAATCCCCCAAAGAAGGTAAAGGAAGCAAGTCTTCCCCACTCTCTGTAAAGAATGCCAAACGGAAAATGGAAGGCCCAAAGAAAGCCAAGGGCGACAGCCCTGTAAATGGCTTGCTAAAAGGGCAG
GAGAGTCGAAGTCAAAGCAGGAGTCGTGAGCAGAGCTACTCAAGGTCCCCATCACGGTCTGCTTCTCCAAAGAGAAGGAAAAGTGATAGTGGCTCTACCTCAGGGGGGTCCAAGTCACAGAGTCGTTC
TCGGAGCCGCAGTGACTCTCCTCCAAGGCAAGTACACCGTGGTGCTCCCTACAAAGGCTCAGAAGTGAGGGGCTCCCGGAAATCCAAGGACTGCAAGCACCTCACCCAGAAGCCACACAAGTCTCGTA
GCCGGAGCTCCTCCCGTTCCCGCAGCCGGTCACGAGAACGGACAGACAGTTCTGGAAAATACAAGAAGAAAAGTCATTACTATAGAGATCAAAGACGGGAGCGCTCAAGGTCATATGAGCGCACAGGC
CATCGATATGAGAGGGACCACCCTGGACACAGCAGGCATCGGAGGTGAGATAGGTTCCCTGGTGGCTGCCCTTGGTCCCTCCCTGTTGGGCACACCTTGGCTTCAGTGGCCTTGTCACATAATGTTTT
TTTAAAGTGTTTTTGATTGGACCTTGAGGTGAATTTGACAGTGGGCAAGGTGCCCTTCAGGCTGGCCTGGGGAGTGCTGCACATCTGTCCTAGGTAATGGTCCACCTCAACTGCAGACCTTCAGGTAG
CTGGATGGAACAGCAAAGGCACACGCCTCCACTGGCGTGGCTTGGTGCTATTGACAAGCTGTCTCTTCACTCCTAAACTGATACTCAATTACGTTAAGCCAAGAAAGATGATTTTTCAAATCTTTGCC
TATATTAGGTTGTACTTGTGTACATATTTTGCAGTGGTTCACAATGAGAAAATGGCCTTAATAGCCCCCTTGTTCTCTATTCACGTTGTAAATAAACATGTTTAATACAAGTGAAAGCTATATATGAG
AACTCAGAATTTGATTCTGTTAGCTTAACACTTGTATAGAAAATTGAGATTTTTAAAATGTGAAGGTATTTAGGTCTGTGTTGAAAGTCATATATTTTTATCTGTGCAATGCTGAGTGCAGGCCACCA
GCTCGAGAGAAATTTTACGTGGTTGAATAAACAATTCTCAGGACACTTGTTATGTAAGACTTTGTGGGCTGTCATTTTGGTTTTTTTTTGTGTGTGTGTGTGCATGCCTGGGATTTGGCTGTGGGACT
CAGGCCTGGTGGGAGTATTTGTGTGCAACTGTGCACTGCCAGCTTAGCTATTCTAGGGGCTGTATGAGCTGTGTATTCCCTGGTCCTTCATCCCTCTTCTCATTAAAGTGTTGGATTTTGTACTGA

hide sequence

RefSeq Acc Id:

XM_039109721 ⟹ XP_038965649

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,698,951 - 171,711,035 (+)	NCBI
mRatBN7.2	5	166,416,952 - 166,428,997 (+)	NCBI

RefSeq Acc Id:

XM_063287498 ⟹ XP_063143568

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,698,951 - 171,711,035 (+)	NCBI

RefSeq Acc Id:

XM_063287499 ⟹ XP_063143569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,705,820 - 171,711,035 (+)	NCBI

RefSeq Acc Id:

XM_063287500 ⟹ XP_063143570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,698,951 - 171,708,404 (+)	NCBI

RefSeq Acc Id:

XR_005504417

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,698,951 - 171,707,633 (+)	NCBI
mRatBN7.2	5	166,416,944 - 166,425,479 (+)	NCBI


Protein RefSeqs	NP_001388234	(Get FASTA)	NCBI Sequence Viewer
	NP_001388236	(Get FASTA)	NCBI Sequence Viewer
	XP_006239606	(Get FASTA)	NCBI Sequence Viewer
	XP_038965649	(Get FASTA)	NCBI Sequence Viewer
	XP_063143568	(Get FASTA)	NCBI Sequence Viewer
	XP_063143569	(Get FASTA)	NCBI Sequence Viewer
	XP_063143570	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88316	(Get FASTA)	NCBI Sequence Viewer
	EDL81328	(Get FASTA)	NCBI Sequence Viewer
	EDL81329	(Get FASTA)	NCBI Sequence Viewer
	EDL81330	(Get FASTA)	NCBI Sequence Viewer
	EDL81331	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025531
	ENSRNOP00000068952
	ENSRNOP00000077305
GenBank Protein	Q5I0H5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_006239606 ⟸ XM_006239544
- Peptide Label:	isoform X1
- UniProtKB:	A6IUS7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAAAAGASGLMAPALAACSSGSGGAAPGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLDIDTETGLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHL ASKIEEAPRRIRDVINVFHRLRHLREKKKPVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQHLVQTAWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPN RPHWFLLFGATEEEIQEICFKILQLYTRKKVDLTHLESEVEKRKHAIEEAKARAKGLLPPGSAPGLDSATAGFSPAPKPVESPKEGKGSKSSPLSVKNAKRKMEGPKKAKGDSPVNGLLKGQESRSQS RSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKHLTQKPHKSRSRSSSRSRSRSRERTDSSGKYKKKSHYYRDQRRERSRSYERTGHRYERD HPGHSRHRR hide sequence

Ensembl Acc Id:

ENSRNOP00000068952 ⟸ ENSRNOT00000089936

Ensembl Acc Id:

ENSRNOP00000025531 ⟸ ENSRNOT00000025531

Ensembl Acc Id:

ENSRNOP00000025952 ⟸ ENSRNOT00000025952

RefSeq Acc Id:	XP_038965649 ⟸ XM_039109721
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5Y5M3 (UniProtKB/TrEMBL)

Protein Domains

Cyclin C-terminal Cyclin-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0H5-F1-model_v2	AlphaFold	Q5I0H5	1-520	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-38896	BioCyc
Ensembl Genes	ENSRNOG00000018691	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025531	ENTREZGENE
	ENSRNOT00000089936	ENTREZGENE
	ENSRNOT00000096422	ENTREZGENE
Gene3D-CATH	Cyclin-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7325177	IMAGE-MGC_LOAD
InterPro	Cyclin-like	UniProtKB/Swiss-Prot
	Cyclin-like_sf	UniProtKB/Swiss-Prot
	Cyclin/Ssn8	UniProtKB/Swiss-Prot
	Cyclin_C-dom	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109544	IMAGE-MGC_LOAD
NCBI Gene	298686	ENTREZGENE
PANTHER	PTHR10026	UniProtKB/Swiss-Prot
Pfam	Cyclin_C	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
PhenoGen	Ccnl2	PhenoGen
PIRSF	Cyclin_L	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018691	RatGTEx
SMART	CYCLIN	UniProtKB/Swiss-Prot
	Cyclin_C	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47954	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHQ5_RAT	UniProtKB/TrEMBL
	A0A8I5Y5M3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QZY3_RAT	UniProtKB/TrEMBL
	A6IUS7	ENTREZGENE, UniProtKB/TrEMBL
	A6IUS8	ENTREZGENE, UniProtKB/TrEMBL
	A6IUS9_RAT	UniProtKB/TrEMBL
	A6IUT0_RAT	UniProtKB/TrEMBL
	CCNL2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Ccnl2	cyclin L2	Ccnl2_predicted	cyclin L2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ccnl2_predicted	cyclin L2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar