Symbol:
Necap1
Name:
NECAP endocytosis associated 1
RGD ID:
1306053
Description:
Involved in presynaptic endocytosis. Is active in presynapse. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 21. Orthologous to human NECAP1 (NECAP endocytosis associated 1); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
adaptin ear-binding clathrin-associated protein; adaptin ear-binding coat-associated protein 1; LOC312694; MGC114570; NECAP endocytosis-associated protein 1; NECAP-1; RGD1306053; similar to RIKEN cDNA 1200016B17
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 157,775,890 - 157,790,992 (+) NCBI GRCr8 mRatBN7.2 4 156,103,935 - 156,119,068 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 156,103,988 - 156,119,068 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 162,373,641 - 162,388,733 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 158,156,863 - 158,171,955 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 156,801,946 - 156,817,038 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 155,709,712 - 155,724,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 155,709,613 - 155,724,790 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 222,730,478 - 222,745,567 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 159,354,507 - 159,369,596 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 159,599,461 - 159,614,524 (+) NCBI Celera 4 144,924,247 - 144,939,336 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Necap1 Rat (1->4)-beta-D-glucan multiple interactions ISO Necap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NECAP1 mRNA CTD PMID:36331819 Necap1 Rat 1,2-dimethylhydrazine decreases expression ISO Necap1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NECAP1 mRNA CTD PMID:22206623 Necap1 Rat 1,2-dimethylhydrazine multiple interactions ISO Necap1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NECAP1 mRNA CTD PMID:22206623 Necap1 Rat 17beta-estradiol decreases expression ISO Necap1 (Mus musculus) 6480464 Estradiol results in decreased expression of NECAP1 mRNA CTD PMID:39298647 Necap1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Necap1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of NECAP1 mRNA CTD PMID:16214954 Necap1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Necap1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NECAP1 mRNA CTD PMID:21570461 Necap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Necap1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NECAP1 mRNA CTD PMID:19770486 Necap1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Necap1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NECAP1 mRNA CTD PMID:26251327 Necap1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NECAP1 mRNA CTD PMID:36041667 Necap1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NECAP1 protein CTD PMID:19059321 Necap1 Rat aflatoxin B1 increases expression ISO Necap1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NECAP1 mRNA CTD PMID:19770486 Necap1 Rat aflatoxin B1 decreases methylation ISO NECAP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NECAP1 gene CTD PMID:27153756 Necap1 Rat all-trans-retinoic acid increases expression ISO NECAP1 (Homo sapiens) 6480464 Tretinoin results in increased expression of NECAP1 mRNA CTD PMID:33167477 Necap1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NECAP1 mRNA CTD PMID:38685447 Necap1 Rat arsane multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat arsenic atom multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat benzo[a]pyrene affects methylation ISO NECAP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NECAP1 promoter CTD PMID:27901495 Necap1 Rat beta-lapachone increases expression ISO NECAP1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of NECAP1 mRNA CTD PMID:38218311 Necap1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NECAP1 mRNA CTD PMID:25181051 Necap1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NECAP1 mRNA CTD PMID:36041667 Necap1 Rat bisphenol A increases expression ISO NECAP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of NECAP1 protein CTD PMID:34186270 Necap1 Rat bisphenol A multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of NECAP1 gene CTD PMID:31601247 Necap1 Rat bisphenol F increases expression ISO Necap1 (Mus musculus) 6480464 bisphenol F results in increased expression of NECAP1 mRNA CTD PMID:38685157 Necap1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NECAP1 mRNA CTD PMID:36041667 Necap1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of NECAP1 mRNA CTD PMID:33453195 Necap1 Rat cadmium dichloride decreases expression ISO NECAP1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NECAP1 mRNA CTD PMID:38382870 Necap1 Rat CGP 52608 multiple interactions ISO NECAP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NECAP1 gene] CTD PMID:28238834 Necap1 Rat copper(II) sulfate increases expression ISO NECAP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NECAP1 mRNA CTD PMID:19549813 Necap1 Rat cyclosporin A increases expression ISO Necap1 (Mus musculus) 6480464 Cyclosporine results in increased expression of NECAP1 mRNA CTD PMID:19770486 Necap1 Rat cyclosporin A increases expression ISO NECAP1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NECAP1 mRNA CTD PMID:25562108 Necap1 Rat Dibutyl phosphate affects expression ISO NECAP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NECAP1 mRNA CTD PMID:37042841 Necap1 Rat ethanol affects splicing ISO Necap1 (Mus musculus) 6480464 Ethanol affects the splicing of NECAP1 mRNA CTD PMID:30319688 Necap1 Rat ethanol increases expression ISO Necap1 (Mus musculus) 6480464 Ethanol results in increased expression of NECAP1 mRNA CTD PMID:30319688 Necap1 Rat folic acid multiple interactions ISO Necap1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NECAP1 mRNA CTD PMID:22206623 Necap1 Rat fulvestrant multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of NECAP1 gene CTD PMID:31601247 Necap1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NECAP1 mRNA CTD PMID:33387578 Necap1 Rat hydrogen peroxide affects expression ISO NECAP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of NECAP1 mRNA CTD PMID:23410634 Necap1 Rat lead(0) affects expression ISO NECAP1 (Homo sapiens) 6480464 Lead affects the expression of NECAP1 mRNA CTD PMID:28903495 Necap1 Rat maneb multiple interactions ISO Necap1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of NECAP1 mRNA CTD PMID:36117858 Necap1 Rat manganese atom multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat manganese(0) multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat manganese(II) chloride multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat menadione affects expression ISO NECAP1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of NECAP1 mRNA CTD PMID:23410634 Necap1 Rat microcystin-LR decreases expression ISO Necap1 (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of NECAP1 protein CTD PMID:26984711 Necap1 Rat paraquat multiple interactions ISO Necap1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of NECAP1 mRNA CTD PMID:36117858 Necap1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Necap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NECAP1 mRNA CTD PMID:36331819 Necap1 Rat sodium arsenite affects methylation ISO NECAP1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of NECAP1 gene CTD PMID:28589171 Necap1 Rat sodium arsenite multiple interactions ISO NECAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NECAP1 mRNA CTD PMID:39836092 Necap1 Rat sodium arsenite increases expression ISO NECAP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NECAP1 mRNA CTD PMID:38568856 Necap1 Rat sodium fluoride decreases expression ISO Necap1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of NECAP1 mRNA CTD PMID:27862939 Necap1 Rat sunitinib increases expression ISO NECAP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of NECAP1 mRNA CTD PMID:31533062 Necap1 Rat tert-butyl hydroperoxide affects expression ISO NECAP1 (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of NECAP1 mRNA CTD PMID:23410634 Necap1 Rat testosterone decreases expression ISO Necap1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of NECAP1 mRNA CTD PMID:33848595 Necap1 Rat titanium dioxide increases methylation ISO Necap1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NECAP1 gene CTD PMID:35295148 Necap1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of NECAP1 gene CTD PMID:27618143 Necap1 Rat triphenyl phosphate affects expression ISO NECAP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NECAP1 mRNA CTD PMID:37042841 Necap1 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of NECAP1 protein CTD PMID:32519852 Necap1 Rat trovafloxacin increases expression ISO Necap1 (Mus musculus) 6480464 trovafloxacin results in increased expression of NECAP1 mRNA CTD PMID:35537566 Necap1 Rat valproic acid increases expression ISO NECAP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NECAP1 mRNA CTD PMID:29154799 Necap1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NECAP1 mRNA CTD PMID:19015723 Necap1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NECAP1 mRNA CTD PMID:20566332
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Characterization of the localization and function of NECAP 1 in neurons.
Murshid A, etal., J Neurochem. 2006 Sep;98(6):1746-62. doi: 10.1111/j.1471-4159.2006.04066.x. Epub 2006 Jul 31.
3.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
4.
GOA pipeline
RGD automated data pipeline
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
The NECAP PHear domain increases clathrin accessory protein binding potential.
Ritter B, etal., EMBO J. 2007 Sep 19;26(18):4066-77. Epub 2007 Aug 30.
8.
NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.
Ritter B, etal., PLoS Biol. 2013 Oct;11(10):e1001670. doi: 10.1371/journal.pbio.1001670. Epub 2013 Oct 1.
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Necap1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 157,775,890 - 157,790,992 (+) NCBI GRCr8 mRatBN7.2 4 156,103,935 - 156,119,068 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 156,103,988 - 156,119,068 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 162,373,641 - 162,388,733 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 158,156,863 - 158,171,955 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 156,801,946 - 156,817,038 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 155,709,712 - 155,724,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 155,709,613 - 155,724,790 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 222,730,478 - 222,745,567 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 159,354,507 - 159,369,596 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 159,599,461 - 159,614,524 (+) NCBI Celera 4 144,924,247 - 144,939,336 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
NECAP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 8,082,274 - 8,097,881 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 8,076,939 - 8,097,881 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 8,234,870 - 8,250,477 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 7,989,001 - 8,141,634 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 9,811,877 - 9,827,432 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 8,046,534 - 8,062,074 (+) NCBI HuRef CHM1_1 12 8,234,026 - 8,249,598 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 8,095,874 - 8,111,478 (+) NCBI T2T-CHM13v2.0
Necap1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 122,851,516 - 122,865,902 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 122,851,433 - 122,865,900 (+) Ensembl GRCm39 Ensembl GRCm38 6 122,874,557 - 122,888,943 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 122,874,474 - 122,888,941 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 122,824,575 - 122,838,959 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 122,840,176 - 122,854,560 (+) NCBI MGSCv36 mm8 Celera 6 124,676,728 - 124,691,173 (+) NCBI Celera Cytogenetic Map 6 F2 NCBI cM Map 6 57.96 NCBI
Necap1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 6,737,785 - 6,754,162 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 6,737,785 - 6,751,672 (+) NCBI ChiLan1.0 ChiLan1.0
NECAP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 13,635,763 - 13,653,693 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 13,632,524 - 13,654,420 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 8,201,908 - 8,217,043 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 8,244,137 - 8,259,247 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 8,243,785 - 8,282,647 (+) Ensembl panpan1.1 panPan2
NECAP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 37,460,545 - 37,472,512 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 37,460,607 - 37,507,052 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 9,143,445 - 9,155,412 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 37,814,521 - 37,826,493 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 37,814,508 - 37,864,273 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 37,689,204 - 37,701,156 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 37,730,473 - 37,742,640 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 8,630,216 - 8,642,197 (-) NCBI UU_Cfam_GSD_1.0
Necap1
NECAP1
NECAP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 8,155,432 - 8,170,873 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 8,154,976 - 8,171,025 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666089 251,027 - 267,789 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Necap1
.
Predicted Target Of
Count of predictions: 236 Count of miRNA genes: 149 Interacting mature miRNAs: 188 Transcripts: ENSRNOT00000013272 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 731178 Oia7 Oil induced arthritis QTL 7 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 156050654 157232313 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
AA998017
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 156,113,085 - 156,113,229 (+) MAPPER mRatBN7.2 Rnor_6.0 4 155,718,820 - 155,718,963 NCBI Rnor6.0 Rnor_5.0 4 222,739,586 - 222,739,729 UniSTS Rnor5.0 RGSC_v3.4 4 159,363,615 - 159,363,758 UniSTS RGSC3.4 Celera 4 144,933,355 - 144,933,498 UniSTS RH 3.4 Map 4 1002.9 UniSTS Cytogenetic Map 4 q42 UniSTS
RH141222
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 156,118,668 - 156,118,859 (+) MAPPER mRatBN7.2 Rnor_6.0 4 155,724,402 - 155,724,592 NCBI Rnor6.0 Rnor_5.0 4 222,745,168 - 222,745,358 UniSTS Rnor5.0 RGSC_v3.4 4 159,369,197 - 159,369,387 UniSTS RGSC3.4 Celera 4 144,938,937 - 144,939,127 UniSTS RH 3.4 Map 4 1002.1 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013272 ⟹ ENSRNOP00000013272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 156,103,988 - 156,119,068 (+) Ensembl Rnor_6.0 Ensembl 4 155,709,613 - 155,724,790 (+) Ensembl
RefSeq Acc Id:
NM_001029919 ⟹ NP_001025090
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 157,775,903 - 157,790,992 (+) NCBI mRatBN7.2 4 156,103,978 - 156,119,068 (+) NCBI Rnor_6.0 4 155,709,712 - 155,724,801 (+) NCBI Rnor_5.0 4 222,730,478 - 222,745,567 (+) NCBI RGSC_v3.4 4 159,354,507 - 159,369,596 (+) RGD Celera 4 144,924,247 - 144,939,336 (+) RGD
Sequence:
CGGCGCTAGCGGAGCCAAGATGGCGGCGGAGCTGGAATACGAGTCTGTGCTGTGTGTGAAGCCCGACGTCAGCGTCTACCGGATTCCGCCGCGGGCCTCCAACCGCGGTTACAGGGCATCTGACTGGA
hide sequence
RefSeq Acc Id:
XM_006237305 ⟹ XP_006237367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 157,775,890 - 157,790,911 (+) NCBI mRatBN7.2 4 156,103,959 - 156,119,068 (+) NCBI Rnor_6.0 4 155,709,736 - 155,724,801 (+) NCBI Rnor_5.0 4 222,730,478 - 222,745,567 (+) NCBI
Sequence:
GGCGGAGCTGGAATACGAGTCTGTGCTGTGTGTGAAGCCCGACGTCAGCGTCTACCGGATTCCG
hide sequence
RefSeq Acc Id:
NP_001025090 ⟸ NM_001029919
- UniProtKB:
Q4QR67 (UniProtKB/Swiss-Prot), P69682 (UniProtKB/Swiss-Prot), A6ILG2 (UniProtKB/TrEMBL), A0A8L2Q6N8 (UniProtKB/TrEMBL)
- Sequence:
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETVADSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFK
hide sequence
RefSeq Acc Id:
XP_006237367 ⟸ XM_006237305
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q6N8 (UniProtKB/TrEMBL)
- Sequence:
MKQPQVQSKSRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELFAQAPVEQYPGIAVETV
hide sequence
Ensembl Acc Id:
ENSRNOP00000013272 ⟸ ENSRNOT00000013272
RGD ID: 13693373 Promoter ID: EPDNEW_R3898 Type: multiple initiation site Name: Necap1_1 Description: NECAP endocytosis associated 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 155,709,719 - 155,709,779 EPDNEW
BioCyc Gene G2FUF-43139 BioCyc
Ensembl Genes ENSRNOG00000009236 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000013272 ENTREZGENE
ENSRNOT00000013272.7 UniProtKB/TrEMBL
ENSRNOT00000146409 ENTREZGENE
Gene3D-CATH 2.30.29.30 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7461823 IMAGE-MGC_LOAD
InterPro NECAP_PHear UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PH-like_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:312694 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:114570 IMAGE-MGC_LOAD
NCBI Gene 312694 ENTREZGENE
PANTHER ADAPTIN EAR-BINDING COAT-ASSOCIATED PROTEIN 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ATP-BINDING CASSETTE ABC TRANSPORTER-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam DUF1681 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Necap1 PhenoGen
RatGTEx ENSRNOG00000009236 RatGTEx
Superfamily-SCOP PH domain-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8L2Q6N8 ENTREZGENE, UniProtKB/TrEMBL
A6ILG2 ENTREZGENE, UniProtKB/TrEMBL
NECP1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q4QR67 ENTREZGENE
UniProt Secondary Q4QR67 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Necap1
NECAP endocytosis associated 1
RGD1306053
similar to RIKEN cDNA 1200016B17
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1306053
similar to RIKEN cDNA 1200016B17
RGD1306053_predicted
similar to RIKEN cDNA 1200016B17 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1306053_predicted
similar to RIKEN cDNA 1200016B17 (predicted)
LOC312694_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC312694_predicted
similar to RIKEN cDNA 1200016B17 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
