Symbol:
Trim46
Name:
tripartite motif-containing 46
RGD ID:
1305993
Description:
Predicted to enable zinc ion binding activity. Involved in negative regulation of axon extension; positive regulation of anterograde dense core granule transport; and regulation of protein localization. Located in main axon. Orthologous to human TRIM46 (tripartite motif containing 46); INTERACTS WITH alpha-Zearalanol; bisphenol A; furan.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC103690106; LOC310641; tripartite motif protein 46; tripartite motif-containing protein 46; tripartite motif-containing protein 46-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,939,253 - 176,952,285 (-) NCBI GRCr8 mRatBN7.2 2 174,641,494 - 174,654,237 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,641,496 - 174,654,141 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,787,348 - 181,800,023 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,809,722 - 179,822,396 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,409,497 - 174,422,170 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,548,608 - 188,561,617 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,548,644 - 188,561,360 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,963,152 - 207,981,078 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,404,410 - 181,417,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,354,507 - 181,367,202 (-) NCBI Celera 2 168,583,808 - 168,596,477 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Only show annotations with direct experimental evidence (0 objects hidden)
Trim46 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TRIM46 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TRIM46 mRNA CTD PMID:22079256 Trim46 Rat 1,2-dimethylhydrazine decreases expression ISO Trim46 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TRIM46 mRNA CTD PMID:22206623 Trim46 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Trim46 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TRIM46 mRNA CTD PMID:21570461 Trim46 Rat 2-methylcholine affects expression ISO TRIM46 (Homo sapiens) 6480464 beta-methylcholine affects the expression of TRIM46 mRNA CTD PMID:21179406 Trim46 Rat 3,3',5-triiodo-L-thyronine increases expression ISO TRIM46 (Homo sapiens) 6480464 Triiodothyronine results in increased expression of TRIM46 mRNA CTD PMID:23397585 Trim46 Rat 4,4'-sulfonyldiphenol increases methylation ISO Trim46 (Mus musculus) 6480464 bisphenol S results in increased methylation of TRIM46 exon CTD PMID:33297965 Trim46 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione affects abundance ISO TRIM46 (Homo sapiens) 6480464 TRIM46 gene SNP affects the abundance of Uric Acid CTD PMID:23263486 Trim46 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TRIM46 mRNA CTD PMID:35163327 Trim46 Rat antirheumatic drug decreases expression ISO TRIM46 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TRIM46 mRNA CTD PMID:24449571 Trim46 Rat aristolochic acid A increases expression ISO TRIM46 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TRIM46 mRNA CTD PMID:33212167 Trim46 Rat atrazine increases expression ISO TRIM46 (Homo sapiens) 6480464 Atrazine results in increased expression of TRIM46 mRNA CTD PMID:22378314 Trim46 Rat benzo[a]pyrene affects methylation ISO TRIM46 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TRIM46 promoter CTD PMID:27901495 Trim46 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TRIM46 mRNA CTD PMID:25181051 Trim46 Rat bisphenol A decreases expression ISO Trim46 (Mus musculus) 6480464 bisphenol A results in decreased expression of TRIM46 mRNA CTD PMID:32156529 Trim46 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TRIM46 gene CTD PMID:28505145 Trim46 Rat bisphenol F decreases expression ISO Trim46 (Mus musculus) 6480464 bisphenol F results in decreased expression of TRIM46 mRNA CTD PMID:38685157 Trim46 Rat cadmium dichloride decreases expression ISO TRIM46 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TRIM46 mRNA CTD PMID:26472689 Trim46 Rat chlorpyrifos increases expression ISO Trim46 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TRIM46 mRNA CTD PMID:37019170 Trim46 Rat cyclosporin A increases expression ISO Trim46 (Mus musculus) 6480464 Cyclosporine results in increased expression of TRIM46 mRNA CTD PMID:19770486 Trim46 Rat Dibutyl phosphate affects expression ISO TRIM46 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TRIM46 mRNA CTD PMID:37042841 Trim46 Rat diclofenac decreases expression ISO Trim46 (Mus musculus) 6480464 Diclofenac results in decreased expression of TRIM46 mRNA CTD PMID:35537566 Trim46 Rat furan increases expression EXP 6480464 furan results in increased expression of TRIM46 mRNA CTD PMID:27387713 Trim46 Rat hydralazine multiple interactions ISO TRIM46 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TRIM46 mRNA CTD PMID:17183730 Trim46 Rat ozone multiple interactions ISO Trim46 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TRIM46 mRNA CTD PMID:34911549 Trim46 Rat paracetamol increases expression ISO TRIM46 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TRIM46 mRNA CTD PMID:26690555 Trim46 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TRIM46 mRNA CTD PMID:35163327 Trim46 Rat potassium chromate increases expression ISO TRIM46 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TRIM46 mRNA CTD PMID:22079256 Trim46 Rat potassium chromate multiple interactions ISO TRIM46 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TRIM46 mRNA CTD PMID:22079256 Trim46 Rat propanal increases expression ISO TRIM46 (Homo sapiens) 6480464 propionaldehyde results in increased expression of TRIM46 mRNA CTD PMID:26079696 Trim46 Rat silver atom increases expression ISO Trim46 (Mus musculus) 6480464 Silver results in increased expression of TRIM46 mRNA CTD PMID:27131904 Trim46 Rat silver(0) increases expression ISO Trim46 (Mus musculus) 6480464 Silver results in increased expression of TRIM46 mRNA CTD PMID:27131904 Trim46 Rat triptonide decreases expression ISO Trim46 (Mus musculus) 6480464 triptonide results in decreased expression of TRIM46 mRNA CTD PMID:33045310 Trim46 Rat trovafloxacin decreases expression ISO Trim46 (Mus musculus) 6480464 trovafloxacin results in decreased expression of TRIM46 mRNA CTD PMID:35537566 Trim46 Rat valproic acid multiple interactions ISO TRIM46 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of TRIM46 mRNA CTD PMID:17183730
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-methylcholine (ISO) 3,3',5-triiodo-L-thyronine (ISO) 4,4'-sulfonyldiphenol (ISO) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) furan (EXP) hydralazine (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (EXP) potassium chromate (ISO) propanal (ISO) silver atom (ISO) silver(0) (ISO) triptonide (ISO) trovafloxacin (ISO) valproic acid (ISO)
Biological Process
anterograde synaptic vesicle transport (IBA,IEA,ISO) axonogenesis (IBA,IEA,ISO) microtubule bundle formation (IBA,IEA,ISO) microtubule cytoskeleton organization (ISO) negative regulation of axon extension (IMP) neuron migration (IBA,IEA,ISO) positive regulation of anterograde dense core granule transport (IMP) protein localization to axon (IEA,ISO) regulation of protein localization (IEA,IMP,ISO)
References
Additional References at PubMed
Genomics
Comparative Map Data
Trim46 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,939,253 - 176,952,285 (-) NCBI GRCr8 mRatBN7.2 2 174,641,494 - 174,654,237 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,641,496 - 174,654,141 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,787,348 - 181,800,023 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,809,722 - 179,822,396 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,409,497 - 174,422,170 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,548,608 - 188,561,617 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,548,644 - 188,561,360 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,963,152 - 207,981,078 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,404,410 - 181,417,003 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,354,507 - 181,367,202 (-) NCBI Celera 2 168,583,808 - 168,596,477 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
TRIM46 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 155,173,849 - 155,184,971 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 155,173,787 - 155,184,971 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 155,146,325 - 155,157,447 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 153,412,984 - 153,424,069 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 151,959,432 - 151,970,518 NCBI Celera 1 128,217,624 - 128,228,710 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI HuRef 1 126,508,655 - 126,520,717 (+) NCBI HuRef CHM1_1 1 156,542,118 - 156,553,302 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 154,313,465 - 154,324,587 (+) NCBI T2T-CHM13v2.0
Trim46 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 89,141,476 - 89,153,655 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 89,141,484 - 89,153,616 (-) Ensembl GRCm39 Ensembl GRCm38 3 89,234,169 - 89,246,358 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 89,234,177 - 89,246,309 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 89,038,099 - 89,049,819 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 89,320,104 - 89,331,824 (-) NCBI MGSCv36 mm8 Celera 3 89,268,050 - 89,279,844 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.02 NCBI
Trim46 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 1,646,244 - 1,656,825 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 1,646,244 - 1,656,825 (+) NCBI ChiLan1.0 ChiLan1.0
TRIM46 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 94,656,387 - 94,667,520 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 94,387,823 - 94,398,943 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 130,521,472 - 130,532,636 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 134,129,984 - 134,141,114 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 134,129,984 - 134,142,362 (+) Ensembl panpan1.1 panPan2
TRIM46 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 42,345,506 - 42,354,667 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 42,345,523 - 42,354,557 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 41,836,083 - 41,845,231 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 42,214,710 - 42,223,858 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 42,214,717 - 42,223,845 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 41,994,528 - 42,003,676 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 42,048,391 - 42,057,538 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 42,332,013 - 42,341,161 (-) NCBI UU_Cfam_GSD_1.0
Trim46 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 25,648,442 - 25,659,840 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 4,678,827 - 4,690,236 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 4,678,855 - 4,690,222 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TRIM46 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 94,632,077 - 94,642,705 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 94,632,073 - 94,642,756 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 103,414,718 - 103,425,357 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRIM46 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 8,647,598 - 8,659,674 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 8,648,373 - 8,658,600 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 7,975,144 - 7,986,334 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trim46
.
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 425 Count of miRNA genes: 207 Interacting mature miRNAs: 257 Transcripts: ENSRNOT00000038535 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCr8)
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 61457 Niddm8 Non-insulin dependent diabetes mellitus QTL 8 4.1 0.01 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 2 174543008 175950118 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 61473 Bp19 Blood pressure QTL 19 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 7488904 Bp363 Blood pressure QTL 363 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 172982062 175950118 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
Markers in Region
UniSTS:224858
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,654,630 - 174,654,808 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,561,770 - 188,561,947 NCBI Rnor6.0 Rnor_5.0 2 207,975,298 - 207,975,475 UniSTS Rnor5.0 RGSC_v3.4 2 181,417,506 - 181,417,683 UniSTS RGSC3.4 Celera 2 168,596,980 - 168,597,157 UniSTS Cytogenetic Map 2 q34 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
42
113
87
86
55
25
55
6
201
88
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Sequence
Ensembl Acc Id:
ENSRNOT00000077074 ⟹ ENSRNOP00000075661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,641,496 - 174,654,141 (-) Ensembl Rnor_6.0 Ensembl 2 188,549,080 - 188,553,289 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077446
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 188,557,137 - 188,557,909 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088199 ⟹ ENSRNOP00000071982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 188,557,571 - 188,559,882 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088822 ⟹ ENSRNOP00000075503
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,641,501 - 174,653,504 (-) Ensembl Rnor_6.0 Ensembl 2 188,549,080 - 188,553,289 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089781 ⟹ ENSRNOP00000070340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,641,503 - 174,654,141 (-) Ensembl Rnor_6.0 Ensembl 2 188,548,644 - 188,561,267 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092093 ⟹ ENSRNOP00000073021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 188,557,421 - 188,561,360 (-) Ensembl
RefSeq Acc Id:
NM_001395105 ⟹ NP_001382034
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,253 - 176,951,926 (-) NCBI mRatBN7.2 2 174,641,494 - 174,654,168 (-) NCBI
RefSeq Acc Id:
XM_008761171 ⟹ XP_008759393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,345 (-) NCBI mRatBN7.2 2 174,641,494 - 174,653,587 (-) NCBI Rnor_6.0 2 188,548,608 - 188,560,718 (-) NCBI
Sequence:
CTCTCCCAGAGGCGGTGCCAACCCTGCTCCCCCCCACCACTTCCTTCCCCCTCCCTCCCTGTCCCTCCCTCCTTTGTGTCAGCTGCGCCCCTGACCGGGATGGCTGCGAAGAGAGGGACCAAGACAAG
hide sequence
RefSeq Acc Id:
XM_008761172 ⟹ XP_008759394
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,939 (-) NCBI mRatBN7.2 2 174,641,494 - 174,654,166 (-) NCBI Rnor_6.0 2 188,548,608 - 188,561,256 (-) NCBI
Sequence:
CGGGCACAGTAGGGCCATGGCTGAGGGTGAGGATATGCAGACCTTCACTTCCATCATGGATGCACTAGTCCGCATCAGTGTGAGTTAAGACAAGCATGAAGAACATGGAGAAGGAACTGCTGTGCCCA
hide sequence
RefSeq Acc Id:
XM_008761173 ⟹ XP_008759395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,345 (-) NCBI mRatBN7.2 2 174,641,494 - 174,653,587 (-) NCBI Rnor_6.0 2 188,549,550 - 188,560,717 (-) NCBI
Sequence:
TCTCCCAGAGGCGGTGCCAACCCTGCTCCCCCCCACCACTTCCTTCCCCCTCCCTCCCTGTCCCTCCCTCCTTTGTGTCAGCTGCGCCCCTGACCGGGATGGCTGCGAAGAGAGGGACCAAGACAAGC
hide sequence
RefSeq Acc Id:
XM_017590890 ⟹ XP_017446379
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,995 (-) NCBI mRatBN7.2 2 174,641,494 - 174,654,237 (-) NCBI Rnor_6.0 2 188,549,550 - 188,561,333 (-) NCBI
Sequence:
CTCCCTACACCCCACCCGGCTCCTGCATTAAGCCCCGGGTTCGCAGCAGCAGCCAGGATCGTGC
hide sequence
RefSeq Acc Id:
XM_039102334 ⟹ XP_038958262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,927 (-) NCBI mRatBN7.2 2 174,641,494 - 174,654,159 (-) NCBI
RefSeq Acc Id:
XM_039102335 ⟹ XP_038958263
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,951,927 (-) NCBI mRatBN7.2 2 174,641,494 - 174,654,173 (-) NCBI
RefSeq Acc Id:
XM_063281863 ⟹ XP_063137933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,939,257 - 176,952,285 (-) NCBI
RefSeq Acc Id:
XR_010063609
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,941,529 - 176,951,995 (-) NCBI
RefSeq Acc Id:
XR_010063610
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 176,941,529 - 176,951,345 (-) NCBI
RefSeq Acc Id:
XP_008759394 ⟸ XM_008761172
- Peptide Label:
isoform X2
- Sequence:
MKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGERGLSGLFRNL
hide sequence
RefSeq Acc Id:
XP_008759393 ⟸ XM_008761171
- Peptide Label:
isoform X1
- UniProtKB:
A0A5H1ZRV2 (UniProtKB/TrEMBL)
- Sequence:
MAAKRGTKTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGE
hide sequence
RefSeq Acc Id:
XP_008759395 ⟸ XM_008761173
- Peptide Label:
isoform X4
- Sequence:
MAAKRGTKTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGE
hide sequence
RefSeq Acc Id:
XP_017446379 ⟸ XM_017590890
- Peptide Label:
isoform X3
- Sequence:
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000073021 ⟸ ENSRNOT00000092093
Ensembl Acc Id:
ENSRNOP00000075661 ⟸ ENSRNOT00000077074
Ensembl Acc Id:
ENSRNOP00000070340 ⟸ ENSRNOT00000089781
Ensembl Acc Id:
ENSRNOP00000075503 ⟸ ENSRNOT00000088822
Ensembl Acc Id:
ENSRNOP00000071982 ⟸ ENSRNOT00000088199
RefSeq Acc Id:
XP_038958263 ⟸ XM_039102335
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038958262 ⟸ XM_039102334
- Peptide Label:
isoform X5
RefSeq Acc Id:
NP_001382034 ⟸ NM_001395105
- UniProtKB:
A0A0G2JXN2 (UniProtKB/Swiss-Prot), A0A096MKD9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063137933 ⟸ XM_063281863
- Peptide Label:
isoform X5
Additional Information
External Database Links
Database Acc Id Source(s)
AGR Gene RGD:1305993 AgrOrtholog
BioCyc Gene G2FUF-52431 BioCyc
Ensembl Genes ENSRNOG00000055433 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000077074 UniProtKB/TrEMBL
ENSRNOT00000077074.2 UniProtKB/Swiss-Prot
ENSRNOT00000088822.2 UniProtKB/TrEMBL
ENSRNOT00000089781.2 UniProtKB/TrEMBL
Gene3D-CATH 1.20.5.170 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.60.120.920 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.60.40.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.30.40.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
4.10.830.40 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Classic Zinc Finger UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro B30.2/SPRY UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
B30.2/SPRY_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ConA-like_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
COS_domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
E3_ligase_FN3/SPRY UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
FN3_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
FN3_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ig-like_fold UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Midline-1_COS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SPRY/PRY_TRIM46 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf-RING_euk UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_B-box UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_RING UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_RING/FYVE/PHD UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_RING_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 310641 ENTREZGENE
PANTHER E3 UBIQUITIN-PROTEIN LIGASE TRIM36-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TRIPARTITE MOTIF-CONTAINING PROTEIN 46 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam COS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
zf-B_box UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
zf-RING_UBOX UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Trim46 PhenoGen
PROSITE B302_SPRY UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
COS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
FN3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZF_BBOX UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZF_RING_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000055433 RatGTEx
SMART BBOX UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RING UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP B-box zinc-binding domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RING/U-box UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF49265 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF49899 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A096MJK9_RAT UniProtKB/TrEMBL
A0A096MKD9 ENTREZGENE
A0A0G2JXN2 ENTREZGENE
A0A5H1ZRU8_RAT UniProtKB/TrEMBL
A0A5H1ZRV2 ENTREZGENE, UniProtKB/TrEMBL
TRI46_RAT UniProtKB/Swiss-Prot
UniProt Secondary A0A096MKD9 UniProtKB/Swiss-Prot
Nomenclature History
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Trim46
tripartite motif-containing 46
LOC103690106
tripartite motif-containing protein 46-like
Data merged from RGD:9069427
737654 PROVISIONAL
2014-08-25
LOC103690106
tripartite motif-containing protein 46-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-31
Trim46
tripartite motif-containing 46
Trim46_predicted
tripartite motif protein 46 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Trim46_predicted
tripartite motif protein 46 (predicted)
Symbol and Name status set to approved
70820 APPROVED
