Advanced Search (OLGA)

Gene: Tmed3 (transmembrane p24 trafficking protein 3) Rattus norvegicus

Analyze

Symbol:

Tmed3

Name:

transmembrane p24 trafficking protein 3

RGD ID:

1303327

Description:

Predicted to be involved in Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and intracellular protein transport. Located in Golgi apparatus. Part of COPI vesicle coat. Orthologous to human TMED3 (transmembrane p24 trafficking protein 3); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

integral type I protein; MGC94283; p24 family protein gamma-4; p24gamma4; transmembrane emp24 domain containing 3; transmembrane emp24 domain-containing protein 3; transmembrane emp24 protein transport domain containing 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMED3 (transmembrane p24 trafficking protein 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tmed3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmed3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMED3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMED3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmed3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMED3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMED3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmed3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tmed3 (transmembrane p24 trafficking protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMED7 (transmembrane p24 trafficking protein 7)	HGNC	OrthoDB
Homo sapiens (human):	RHPN2 (rhophilin Rho GTPase binding protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TMED3 (transmembrane p24 trafficking protein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmed3 (transmembrane p24 trafficking protein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmed3 (transmembrane p24 trafficking protein 3)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F57B10.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F57B10.5	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERP2	Alliance	DIOPT (InParanoid\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	p24-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERP3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	ERP3	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERP4	Alliance	DIOPT (InParanoid\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	99,121,361 - 99,129,653 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	99,121,361 - 99,129,215 (-)	Ensembl				GRCr8
mRatBN7.2	8	90,241,516 - 90,249,429 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	90,241,516 - 90,249,346 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	95,907,053 - 95,914,929 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	94,106,260 - 94,114,136 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	91,962,261 - 91,970,146 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	97,075,194 - 97,083,107 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	97,075,160 - 97,083,120 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	96,576,975 - 96,584,888 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	94,590,177 - 94,598,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	89,787,431 - 89,795,344 (-)	NCBI		Celera
RGSC_v3.1	8	94,609,632 - 94,617,545 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

acrylamide (EXP)

aldehydo-D-glucose (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

coumarin (EXP)

cyclophosphamide (ISO)

cyproconazole (ISO)

D-glucose (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

folic acid (ISO)

glafenine (EXP)

glucose (ISO)

hydralazine (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lead(0) (ISO)

MK-2206 (ISO)

N-nitrosodiethylamine (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (EXP)

sodium arsenite (ISO)

streptozocin (EXP)

tebuconazole (ISO)

testosterone (EXP,ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP,ISO)

troglitazone (ISO)

valproic acid (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA)

Golgi organization (IBA)

intracellular protein transport (IBA)

protein transport (IEA)

Cellular Component

COPI vesicle coat (IBA,IDA)

COPI-coated vesicle membrane (IEA)

COPII-coated ER to Golgi transport vesicle (IBA)

cytoplasmic vesicle (IEA)

endoplasmic reticulum (IBA,IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA)

endoplasmic reticulum-Golgi intermediate compartment (IBA,IEA,ISO,ISS)

endoplasmic reticulum-Golgi intermediate compartment membrane (IEA)

Golgi apparatus (IBA,IDA,IEA,ISO)

Golgi cisterna membrane (IEA)

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.	Barr FA, etal., J Cell Biol. 2001 Dec 10;155(6):885-91. Epub 2001 Dec 10.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Golgin tethers define subpopulations of COPI vesicles.	Malsam J, etal., Science. 2005 Feb 18;307(5712):1095-8.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12237308	PMID:15047867	PMID:15489334

Genomics

Comparative Map Data

Tmed3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	99,121,361 - 99,129,653 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	99,121,361 - 99,129,215 (-)	Ensembl				GRCr8
mRatBN7.2	8	90,241,516 - 90,249,429 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	90,241,516 - 90,249,346 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	95,907,053 - 95,914,929 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	94,106,260 - 94,114,136 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	91,962,261 - 91,970,146 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	97,075,194 - 97,083,107 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	97,075,160 - 97,083,120 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	96,576,975 - 96,584,888 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	94,590,177 - 94,598,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	89,787,431 - 89,795,344 (-)	NCBI		Celera
RGSC_v3.1	8	94,609,632 - 94,617,545 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

TMED3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	79,311,112 - 79,413,886 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	79,311,109 - 79,427,432 (+)	Ensembl			hg38	GRCh38
GRCh37	15	79,603,454 - 79,706,228 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	77,390,546 - 77,402,244 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	77,390,545 - 77,402,243	NCBI
Celera	15	56,540,059 - 56,551,758 (+)	NCBI		Celera
Cytogenetic Map	15	q25.1	NCBI
HuRef	15	56,361,742 - 56,373,441 (+)	NCBI		HuRef
CHM1_1	15	79,721,575 - 79,733,274 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	77,174,633 - 77,277,227 (+)	NCBI		T2T-CHM13v2.0

Tmed3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	89,581,256 - 89,587,096 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	89,581,259 - 89,587,121 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	89,699,203 - 89,705,043 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	89,699,206 - 89,705,068 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	89,594,041 - 89,599,881 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	89,497,098 - 89,502,884 (-)	NCBI		MGSCv36	mm8
Celera	9	89,316,734 - 89,322,572 (-)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI
cM Map	9	47.24	NCBI

Tmed3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955533	327,044 - 335,030 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMED3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	68,565,160 - 68,641,006 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	72,730,839 - 72,806,257 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	58,280,282 - 58,355,677 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	77,238,092 - 77,313,580 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	77,237,664 - 77,313,574 (+)	Ensembl			panPan2	panpan1.1

TMED3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	57,832,349 - 57,839,335 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	57,832,352 - 57,839,981 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	60,490,826 - 60,497,703 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	58,267,780 - 58,274,675 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	58,232,053 - 58,274,669 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	57,764,729 - 57,771,616 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	57,972,225 - 57,979,103 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	58,321,136 - 58,328,013 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tmed3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	119,630,160 - 119,638,736 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	37,478,097 - 37,486,809 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	37,478,225 - 37,486,795 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMED3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	48,431,375 - 48,442,645 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	48,431,629 - 48,442,247 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	53,970,295 - 53,972,517 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMED3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	4,069,389 - 4,080,104 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	4,069,150 - 4,080,083 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	137,768,870 - 137,779,630 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmed3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624941	406,953 - 418,748 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624941	407,043 - 414,667 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tmed3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	81,687,612 - 81,695,335 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tmed3
29 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	61
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000018603
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	97492344	116428905	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

RH131254

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	90,241,533 - 90,241,714 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	97,075,212 - 97,075,392	NCBI	Rnor6.0
Rnor_5.0	8	96,576,993 - 96,577,173	UniSTS	Rnor5.0
RGSC_v3.4	8	94,590,195 - 94,590,375	UniSTS	RGSC3.4
Celera	8	89,787,449 - 89,787,629	UniSTS
RH 3.4 Map	8	1021.3	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018603 ⟹ ENSRNOP00000018603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	99,121,361 - 99,129,215 (-)	Ensembl
mRatBN7.2 Ensembl	8	90,241,516 - 90,249,346 (-)	Ensembl
Rnor_6.0 Ensembl	8	97,075,160 - 97,083,120 (-)	Ensembl

RefSeq Acc Id:

NM_001004249 ⟹ NP_001004249

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	99,121,364 - 99,129,277 (-)	NCBI
mRatBN7.2	8	90,241,516 - 90,249,429 (-)	NCBI
Rnor_6.0	8	97,075,194 - 97,083,107 (-)	NCBI
Rnor_5.0	8	96,576,975 - 96,584,888 (-)	NCBI
RGSC_v3.4	8	94,590,177 - 94,598,090 (-)	RGD
Celera	8	89,787,431 - 89,795,344 (-)	RGD

Sequence:

show sequence

CGGAACCGCTGTGCTGAGCTCGCGCCACGTCTCTTCGGAGGGGCCCCTCCCCTCTGCCTGCTAT
CGCTCCACCGGAGCCTAGAGAAGACAAGGCCCAGAGCATCATGGGCAACGAGGTTCCGCGCGCT
TCATCCTTCCAGATGCTGATGCTGCTGCTGCTCTTGCTCCTGCTCCGGGCCGAGCGACTGCGGG
GCGCTGAGCTCACCTTCGAGCTGCCGGACAACGCCAAGCAGTGCTTCCACGAAGAGGTGGAGCA
GGGCGTGAAGTTCTCTCTGGATTACCAGGTTATCACCGGAGGCCACTACGATGTGGACTGCTAT
GTGGAAGACCCCATGGGCAATATCATCTACAGGGAGACAAAGAAGCAGTATGACAGCTTCACAT
ACAAGACGGAGGTCAAGGGCGTTTACCGGTTCTGCTTCAGTAACGAGTTCTCCACTTTCTCTCA
CAAGACTGTCTACTTTGACTTCCAAGTGGGTGACGAGCCCCCCATTCTCCCAGACATGGGGAAT
AGGGTCACAGCTCTCACTCAGATGGAGTCTGCCTGCGTAACGATTCACGAGGCTCTGAAGACTG
TGATCGACTCCCAGACACATTATCGACTGCGGGAGGCTCAGGACCGAGCCCGAGCTGAAGACCT
TAATAGTCGAGTGTCTTACTGGTCTGTAGGAGAGACTATTGCCCTGTTTGTGGTCAGCTTCAGC
CAGGTGCTACTGCTGAAAAGCTTCTTTACAGAAAAACGACCCATTAACAGAGCTGTCCACTCCT
AACCCTGCAGTTCCTCCCCACAGCCCCTCACACCTCTAGGGTCTCAGGCTCCTGCAGGGATGGC
AGTGTGACACAGGGTGAAGGGAGAGCTACAAGGAGACCAAAGGCCACACTTTGTTGTTTGTGCA
CATATCTGATCCTTGTACTCCAGCAGCTGAAGCTCAGAGCCCAGTAATCTGATTGTATTGTGTG
TGTAACATTGGCCAAAAATGTTTACGGGTCAAACTAGGGATTGGCCACTATGGGAGGGCAGTGA
TCCAGTCTGAGGGAGAACGCCAAATACCCGGGCCTCCAGGGCAGCTTAGGGTCCTGCCACTACT
CCATGATACATCAGTCATTAGATTCTTGTATCTTCTTCCACCTCGAGGAGAAAGGAACCCTGAG
TTCATGCCTTCCCTTCACGGGCCTCTCTATACCTGAGGAAAGCAGGTCTAACCTGGAAGCAGAT
ATACAACCAGGACCCAAATAGTGAGTGGGTGCCCTTGGTTATCTGTGTCTCCTGGAGGCAGAAC
TGTGCTAATAAAAGCCAAGTTTGAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

RefSeq Acc Id:

XM_063265199 ⟹ XP_063121269

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	99,121,361 - 99,129,653 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004249	(Get FASTA)	NCBI Sequence Viewer
	XP_063121269	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79220	(Get FASTA)	NCBI Sequence Viewer
	EDL77572	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018603
GenBank Protein	Q6AY25	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004249 ⟸ NM_001004249
- Peptide Label:	precursor
- UniProtKB:	Q6AY25 (UniProtKB/Swiss-Prot), A6I205 (UniProtKB/TrEMBL), A0A8L2QAC1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGNEVPRASSFQMLMLLLLLLLLRAERLRGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITG GHYDVDCYVEDPMGNIIYRETKKQYDSFTYKTEVKGVYRFCFSNEFSTFSHKTVYFDFQVGDEP PILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETI ALFVVSFSQVLLLKSFFTEKRPINRAVHS hide sequence

Ensembl Acc Id:

ENSRNOP00000018603 ⟸ ENSRNOT00000018603

RefSeq Acc Id:	XP_063121269 ⟸ XM_063265199
- Peptide Label:	isoform X1

Protein Domains

GOLD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY25-F1-model_v2	AlphaFold	Q6AY25	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696174

Promoter ID:

EPDNEW_R6699

Type:

initiation region

Name:

Tmed3_1

Description:

transmembrane p24 trafficking protein 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	97,083,110 - 97,083,170	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303327	AgrOrtholog
BioCyc Gene	G2FUF-29580	BioCyc
Ensembl Genes	ENSRNOG00000013889	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000018603	ENTREZGENE
Gene3D-CATH	GOLD domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131966	IMAGE-MGC_LOAD
InterPro	GOLD_dom	UniProtKB/Swiss-Prot
	GOLD_dom_sf	UniProtKB/Swiss-Prot
	TMP21-related	UniProtKB/Swiss-Prot
KEGG Report	rno:300888	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94283	IMAGE-MGC_LOAD
NCBI Gene	300888	ENTREZGENE
PANTHER	PTHR22811	UniProtKB/Swiss-Prot
Pfam	EMP24_GP25L	UniProtKB/Swiss-Prot
PhenoGen	Tmed3	PhenoGen
PROSITE	GOLD	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013889	RatGTEx
SMART	EMP24_GP25L	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF101576	UniProtKB/Swiss-Prot
UniProt	A0A8L2QAC1	ENTREZGENE, UniProtKB/TrEMBL
	A6I205	ENTREZGENE, UniProtKB/TrEMBL
	Q6AY25	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Tmed3	transmembrane p24 trafficking protein 3	Tmed3	transmembrane emp24 protein transport domain containing 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Tmed3	transmembrane emp24 protein transport domain containing 3	Tmed3	transmembrane emp24 domain containing 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Tmed3	transmembrane emp24 domain containing 3	MGC94283	integral type I protein	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC94283				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message