Arid3c (AT-rich interaction domain 3C)

Gene: Arid3c (AT-rich interaction domain 3C) Rattus norvegicus

Analyze

Symbol:

Arid3c

Name:

AT-rich interaction domain 3C

RGD ID:

1560943

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and membrane raft. Predicted to be active in nucleus. Orthologous to human ARID3C (AT-rich interaction domain 3C); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; paracetamol.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

AT rich interactive domain 3C (BRIGHT-like); AT-rich interactive domain-containing protein 3C; LOC502946; RGD1560943; similar to hypothetical LOC496519

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARID3C (AT-rich interaction domain 3C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Arid3c (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arid3c (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARID3C (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARID3C (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arid3c (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARID3C (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arid3c (AT-rich interaction domain 3C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ARID3C (AT-rich interaction domain 3C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arid3c (AT-rich interaction domain 3C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arid3c (AT rich interactive domain 3C (BRIGHT-like))	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cfi-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	retn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	61,685,511 - 61,692,821 (-)	NCBI		GRCr8
mRatBN7.2	5	56,889,649 - 56,896,959 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	56,890,042 - 56,895,888 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	58,869,550 - 58,875,393 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	60,688,382 - 60,694,225 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	60,674,253 - 60,680,097 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	58,107,182 - 58,114,632 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	58,107,707 - 58,113,553 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,631,772 - 62,637,618 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,148,421 - 59,154,267 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	55,484,083 - 55,489,929 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

anauxetic dysplasia (ISO)

autosomal recessive distal hereditary motor neuronopathy 2 (ISO)

distal arthrogryposis type 1A (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 6 (ISO)

galactosemia (ISO)

hyperphosphatasia with impaired intellectual development syndrome 2 (ISO)

primary ciliary dyskinesia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

cyclosporin A (ISO)

ethylparaben (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

paracetamol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

cytoplasm (ISO)

membrane raft (ISO)

nucleus (IBA,ISO)

Molecular Function

chromatin binding (ISO)

DNA binding (IBA)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:21955986

Genomics

Comparative Map Data

Arid3c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	61,685,511 - 61,692,821 (-)	NCBI		GRCr8
mRatBN7.2	5	56,889,649 - 56,896,959 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	56,890,042 - 56,895,888 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	58,869,550 - 58,875,393 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	60,688,382 - 60,694,225 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	60,674,253 - 60,680,097 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	58,107,182 - 58,114,632 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	58,107,707 - 58,113,553 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,631,772 - 62,637,618 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,148,421 - 59,154,267 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	55,484,083 - 55,489,929 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

ARID3C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	34,621,049 - 34,633,011 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	34,621,049 - 34,629,066 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	34,621,046 - 34,629,063 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	34,611,455 - 34,618,011 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	34,552,959 - 34,559,515 (-)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	34,575,737 - 34,582,294 (-)	NCBI		HuRef
CHM1_1	9	34,621,235 - 34,627,787 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	34,639,596 - 34,650,042 (-)	NCBI		T2T-CHM13v2.0

Arid3c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	41,723,830 - 41,731,226 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	41,723,836 - 41,731,142 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	41,723,831 - 41,731,142 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	41,723,836 - 41,731,142 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	41,670,868 - 41,678,174 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	41,912,903 - 41,918,863 (-)	NCBI		MGSCv36	mm8
Celera	4	41,384,044 - 41,391,382 (-)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	22.01	NCBI

Arid3c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	1,504,032 - 1,510,590 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	1,503,448 - 1,510,965 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARID3C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	89,974,694 - 89,982,711 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	89,975,061 - 89,989,017 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	34,457,638 - 34,466,425 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	35,267,063 - 35,275,057 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	35,267,063 - 35,275,057 (-)	Ensembl	panpan1.1		panPan2

ARID3C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	51,294,605 - 51,301,979 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	51,295,030 - 51,301,547 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	49,922,506 - 49,930,320 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	52,234,892 - 52,242,709 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	52,235,759 - 52,242,279 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	50,897,603 - 50,905,422 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	50,765,803 - 50,773,609 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	51,530,526 - 51,538,340 (-)	NCBI		UU_Cfam_GSD_1.0

Arid3c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	166,157,164 - 166,165,371 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	2,705,121 - 2,711,557 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	2,705,112 - 2,711,557 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARID3C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	32,172,871 - 32,180,604 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	32,171,233 - 32,187,239 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	36,312,954 - 36,321,471 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Arid3c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	39,016,483 - 39,023,668 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	39,016,483 - 39,023,701 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arid3c
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	69
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000046589
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium
Low		2		3		16		7	3
Below cutoff	9	7	2	9	2	49	21	24	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001173981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000046589 ⟹ ENSRNOP00000039046

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	56,890,042 - 56,895,888 (-)	Ensembl
Rnor_6.0 Ensembl	5	58,107,707 - 58,113,553 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110095 ⟹ ENSRNOP00000085659

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	56,890,042 - 56,895,888 (-)	Ensembl

RefSeq Acc Id:

NM_001173981 ⟹ NP_001167452

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	61,685,511 - 61,692,821 (-)	NCBI
mRatBN7.2	5	56,889,649 - 56,896,959 (-)	NCBI
Rnor_6.0	5	58,107,707 - 58,113,553 (-)	NCBI
Rnor_5.0	5	62,631,772 - 62,637,618 (-)	NCBI
Celera	5	55,484,083 - 55,489,929 (-)	NCBI

Sequence:

show sequence

ATGGAGGCCCTGCAGAGGCAGCAGGCAGCACGGCTGGCCCAAGGGGTGGGGCCCTTGGCCCCTC
CACGCCTACCGCTTCCACAGCCTCCTCTGCTTGGCGCCCGGACCCTACAGGCTCCTGAGGGGGC
CTTAGGGGTGGTTGGGGCTGAAGAAGAGGAGGGTGCTGAAGAAGATGAGGAGGGAGAGACACCC
TTAGTGGAAGAGGAGACAGCTGAGCAGAGCCATCCGGGAGCCCGATGTCCCAATTCACCATCCG
GCCAGTCCCCTGGAATCCAGCCACATGAGTGGACCTATGAGGAACAGTTCAAGCAGCTGTATGA
ACTCGACGCGGACCCCAAGAGGAAGGAATTTCTGGATGACCTGTTTAGCTTCATGCAGAAGAGG
GGGACGCCAGTGAACCGGGTGCCCATCATGGCCAAACAGGTCCTGGATCTGTATGCGTTGTTTC
GCTTGGTGACAGCCAAGGGAGGCCTGGTGGAAGTCATCAACCGAAAAGTGTGGCGGGAAGTCAC
ACGCGGCCTCAGTTTGCCCACCACCATCACCTCTGCCGCCTTCACACTACGTACCCAGTACATG
AAGTATTTGTACCCATACGAGTGCGAGACGCGGGCACTCAGTTCTCCAGGGGAGCTCCAGGCTG
CCATAGACAGCAACCGGCGTGAGGGACGTCGCCAGGCCTACACCACGGTCCCGCTCTTCAACTT
AGCAGGACCCACACCTCGGGGCGCTCCTGGTCCCGCCTCGAGTCATGGCCCCGCCCCGACCACG
ACCCCGAATTGCCCCGGTTCCACCCAGGGTTCTGCTTCTGGCTTACCAGCGCATGCTTGTGCTC
AACTGAGCCCCAGCCCAGTAAAGAAAGAGGAGAGTGGAATCCCACCCCCTCGTCTGGCGATACC
TGTGGGCTTGGCCTTGGAGGCTGCACGGGAGAAGCTGGCACCAGAAGAGCCTCCAGAGAAGAGG
GCTGTGCTGATGGGCCCCATGGATCCACCTCGATTGGGAGCAACCCCCAGTTTCCTGCCCCGTG
GCAAGGCTCCCCTAAGGGAAGAGCGGTTGGATGGGCCCCTCAATCTGGCAGGCAGTGGCATCAG
CAGTATCAACATGGCGCTAGAGATCAATGGGGTTGTCTACACTGGTATCCTCTTTGCCCGACGC
CAGCCTGTGCCAGCTTCCTTGGGTCCGACCAATCCTCCACCCCCACCCTCTACAGGGCCCCCTT
CCAGCACCTTACCCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001167452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98688	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000039046
	ENSRNOP00000039046.2
	ENSRNOP00000085659.1

RefSeq Acc Id:

NP_001167452 ⟸ NM_001173981

- UniProtKB:

D3ZQB1 (UniProtKB/TrEMBL), A0A8I6A250 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEALQRQQAARLAQGVGPLAPPRLPLPQPPLLGARTLQAPEGALGVVGAEEEEGAEEDEEGETP
LVEEETAEQSHPGARCPNSPSGQSPGIQPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKR
GTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYM
KYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTTVPLFNLAGPTPRGAPGPASSHGPAPTT
TPNCPGSTQGSASGLPAHACAQLSPSPVKKEESGIPPPRLAIPVGLALEAAREKLAPEEPPEKR
AVLMGPMDPPRLGATPSFLPRGKAPLREERLDGPLNLAGSGISSINMALEINGVVYTGILFARR
QPVPASLGPTNPPPPPSTGPPSSTLP

hide sequence

RefSeq Acc Id:

ENSRNOP00000039046 ⟸ ENSRNOT00000046589

RefSeq Acc Id:

ENSRNOP00000085659 ⟸ ENSRNOT00000110095

Protein Domains

ARID REKLES

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQB1-F1-model_v2	AlphaFold	D3ZQB1	1-410	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560943	AgrOrtholog
BioCyc Gene	G2FUF-41544	BioCyc
Ensembl Genes	ENSRNOG00000013416	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000046589	ENTREZGENE
	ENSRNOT00000046589.3	UniProtKB/TrEMBL
	ENSRNOT00000110095.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.150.60	UniProtKB/TrEMBL
InterPro	ARI3A/B/C	UniProtKB/TrEMBL
	ARID/BRIGHT_DNA-bd	UniProtKB/TrEMBL
	ARID_dom_sf	UniProtKB/TrEMBL
	REKLES_domain	UniProtKB/TrEMBL
KEGG Report	rno:502946	UniProtKB/TrEMBL
NCBI Gene	502946	ENTREZGENE
PANTHER	AT-RICH INTERACTIVE DOMAIN-CONTAINING PROTEIN 3C	UniProtKB/TrEMBL
	PTHR15348	UniProtKB/TrEMBL
Pfam	ARID	UniProtKB/TrEMBL
PhenoGen	Arid3c	PhenoGen
PROSITE	ARID	UniProtKB/TrEMBL
	REKLES	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013416	RatGTEx
SMART	ARID	UniProtKB/TrEMBL
	BRIGHT	UniProtKB/TrEMBL
Superfamily-SCOP	ARID	UniProtKB/TrEMBL
UniProt	A0A8I6A250	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQB1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Arid3c	AT-rich interaction domain 3C	Arid3c	AT rich interactive domain 3C (BRIGHT-like)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Arid3c	AT rich interactive domain 3C (BRIGHT-like)	RGD1560943	RGD1560943	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560943	RGD1560943	RGD1560943_predicted	RGD1560943 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560943_predicted	RGD1560943 (predicted)	LOC502946	similar to Hypothetical LOC496519	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC502946	similar to Hypothetical LOC496519			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar