Akirin2 (akirin 2) - Rat Genome Database

Name: Akirin2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Akirin2 (akirin 2) Rattus norvegicus

Analyze

Symbol:

Akirin2

Name:

akirin 2

RGD ID:

1307791

Description:

Predicted to enable enzyme binding activity; identical protein binding activity; and transcription coregulator activity. Involved in negative regulation of gene expression; negative regulation of transcription by RNA polymerase II; and positive regulation of cell population proliferation. Located in nucleus. Part of transcription repressor complex. Orthologous to human AKIRIN2 (akirin 2); INTERACTS WITH (+)-schisandrin B; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

akirin-2; FBI1; fourteen-three-three beta interactant 1; fourteen-three-three beta interacting-protein 1; LOC297968; RGD1307791; similar to hypothetical protein FLJ10342

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AKIRIN2 (akirin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Akirin2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Akirin2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AKIRIN2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AKIRIN2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Akirin2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AKIRIN2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AKIRIN2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Akirin2 (akirin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	USP29 (ubiquitin specific peptidase 29)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	AKIRIN2 (akirin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Akirin2 (akirin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	akirin2 (akirin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	akir-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	akirin	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	akirin2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	53,897,792 - 53,918,873 (+)	NCBI		GRCr8
mRatBN7.2	5	49,108,231 - 49,122,566 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	49,108,220 - 49,122,568 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	51,301,281 - 51,315,616 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	52,901,514 - 52,915,849 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	52,807,415 - 52,821,750 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	50,001,945 - 50,016,544 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	50,002,184 - 50,016,539 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	54,571,149 - 54,585,491 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	51,152,935 - 51,167,720 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	51,153,288 - 51,167,962 (+)	NCBI
Celera	5	47,859,124 - 47,873,161 (+)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neoplasm Metastasis (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

3,3',5-triiodo-L-thyronine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

capsaicin (EXP)

casticin (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

doxorubicin (ISO)

endosulfan (EXP)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

mitomycin C (ISO)

nickel atom (ISO)

paracetamol (ISO)

potassium chromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

sulforaphane (ISO)

T-2 toxin (EXP,ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

valproic acid (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

cerebral cortex development (ISO,ISS)

defense response to bacterium (ISO,ISS)

embryo development ending in birth or egg hatching (ISO)

innate immune response (IEA)

negative regulation of DNA-templated transcription (IDA)

negative regulation of gene expression (IMP)

negative regulation of transcription by RNA polymerase II (IDA)

nuclear protein quality control by the ubiquitin-proteasome system (ISO,ISS)

positive regulation of adaptive immune response (ISO,ISS)

positive regulation of B cell activation (ISO)

positive regulation of cell population proliferation (IMP)

positive regulation of endopeptidase activity (IMP)

positive regulation of innate immune response (IBA,ISO,ISS)

positive regulation of interleukin-6 production (ISO,ISS)

positive regulation of transcription by RNA polymerase II (IBA,ISO,ISS)

proteasome localization (ISO,ISS)

protein import into nucleus (ISO,ISS)

regulation of muscle cell differentiation (ISO)

response to lipopolysaccharide (ISO)

Cellular Component

chromatin (IBA)

cytoplasm (ISO)

membrane (ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IDA,ISO)

transcription repressor complex (IDA)

Molecular Function

enzyme binding (ISO)

identical protein binding (ISO)

protein binding (IPI,ISO)

protein-macromolecule adaptor activity (ISO,ISS)

transcription coregulator activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A novel binding factor of 14-3-3beta functions as a transcriptional repressor and promotes anchorage-independent growth, tumorigenicity, and metastasis.	Komiya Y, etal., J Biol Chem. 2008 Jul 4;283(27):18753-64. Epub 2008 May 5.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18066067	PMID:23382074	PMID:24223164	PMID:24468084

Genomics

Comparative Map Data

Akirin2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	53,897,792 - 53,918,873 (+)	NCBI		GRCr8
mRatBN7.2	5	49,108,231 - 49,122,566 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	49,108,220 - 49,122,568 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	51,301,281 - 51,315,616 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	52,901,514 - 52,915,849 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	52,807,415 - 52,821,750 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	50,001,945 - 50,016,544 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	50,002,184 - 50,016,539 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	54,571,149 - 54,585,491 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	51,152,935 - 51,167,720 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	51,153,288 - 51,167,962 (+)	NCBI
Celera	5	47,859,124 - 47,873,161 (+)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

AKIRIN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	87,674,860 - 87,702,233 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	87,674,860 - 87,702,233 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	88,384,578 - 88,411,951 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	88,441,693 - 88,468,645 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	88,441,693 - 88,468,645	NCBI
Celera	6	88,802,600 - 88,830,001 (-)	NCBI		Celera
Cytogenetic Map	6	q15	NCBI
HuRef	6	85,599,770 - 85,627,163 (-)	NCBI		HuRef
CHM1_1	6	88,481,916 - 88,509,380 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	88,883,172 - 88,910,565 (-)	NCBI		T2T-CHM13v2.0

Akirin2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	34,550,615 - 34,566,930 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	34,550,937 - 34,566,908 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	34,550,615 - 34,566,965 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	34,550,937 - 34,566,908 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	34,497,864 - 34,514,157 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	34,739,502 - 34,755,795 (+)	NCBI		MGSCv36	mm8
Celera	4	34,280,341 - 34,296,487 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	16.8	NCBI

Akirin2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	14,600,106 - 14,619,069 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	14,600,106 - 14,619,374 (-)	NCBI	ChiLan1.0	ChiLan1.0

AKIRIN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	107,754,665 - 107,784,592 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	105,648,490 - 105,677,166 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	85,549,728 - 85,577,114 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	88,829,673 - 88,850,443 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

AKIRIN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	47,113,856 - 47,132,800 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	47,113,857 - 47,132,555 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	46,920,926 - 46,940,125 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	47,919,212 - 47,938,390 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	47,888,213 - 47,938,830 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	47,211,733 - 47,230,919 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	47,138,797 - 47,157,966 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	47,328,532 - 47,347,744 (-)	NCBI		UU_Cfam_GSD_1.0

Akirin2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	82,248,594 - 82,274,206 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	4,216,955 - 4,221,962 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936510	4,216,893 - 4,221,962 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AKIRIN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	56,046,327 - 56,070,163 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	56,047,188 - 56,075,342 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	62,790,860 - 62,818,337 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AKIRIN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	12,146,228 - 12,175,198 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	188,401,656 - 188,427,615 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Akirin2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624799	6,625,549 - 6,644,286 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624799	6,620,102 - 6,644,286 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Akirin2
60 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	79
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000010962
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat

Markers in Region

RH139650

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	49,120,859 - 49,121,947 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	50,014,831 - 50,015,918	NCBI	Rnor6.0
Rnor_5.0	5	54,583,785 - 54,584,872	UniSTS	Rnor5.0
RGSC_v3.4	5	51,166,014 - 51,167,101	UniSTS	RGSC3.4
Celera	5	47,871,455 - 47,872,542	UniSTS
RH 3.4 Map	5	268.6	UniSTS
Cytogenetic Map	5	q21	UniSTS

UniSTS:234891

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	49,120,341 - 49,120,798 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	50,014,313 - 50,014,769	NCBI	Rnor6.0
Rnor_5.0	5	54,583,267 - 54,583,723	UniSTS	Rnor5.0
RGSC_v3.4	5	51,165,496 - 51,165,952	UniSTS	RGSC3.4
Celera	5	47,870,937 - 47,871,393	UniSTS
Cytogenetic Map	5	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001039914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB234867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010962 ⟹ ENSRNOP00000010962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	49,108,220 - 49,122,568 (+)	Ensembl
Rnor_6.0 Ensembl	5	50,002,184 - 50,016,539 (+)	Ensembl

RefSeq Acc Id:

NM_001039914 ⟹ NP_001035003

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	53,904,535 - 53,918,870 (+)	NCBI
mRatBN7.2	5	49,108,231 - 49,122,566 (+)	NCBI
Rnor_6.0	5	50,002,195 - 50,016,537 (+)	NCBI
Rnor_5.0	5	54,571,149 - 54,585,491 (+)	NCBI
RGSC_v3.4	5	51,152,935 - 51,167,720 (+)	RGD
Celera	5	47,859,124 - 47,873,161 (+)	RGD

Sequence:

show sequence

CTCAGCCCGAGCGCACGGCGGGGGCGGCCCGGCCTCTCGGGAGCGGCCCCGAGCGGGCGGCGCG
ACCCTCGCGCCTCGCCCGCCTGCCCTGTCGCGGCTCCTCTGTCCCGGGCCCCACACCTACCGGG
CACCTCGGAGGGCCCGTTTGCCCCGGTCCTTCCCGGCCCCGCCCGAGCCGGGCCTCGGCTGCCC
GCCGCCATGGCGTGCGGAGCCACTCTGAAAAGGACTCTGGATTTCGACCCACTGCTTAGCCCGG
CATCTCCGAAGCGGAGGCGGTGCGCGCCTTTGTCGGCACCGGCTTCGGCTGCCGCCTCCCCTGC
CGCCGCTACCGCCGCCGCCGCTGCCTCTGCCGCGGCCGCTTCGCCGCAGAAGTATCTCCGGATG
GAGCCTTCCCCCTTCGGCGACGTCTCCTCCCGTCTCACCACAGAACAAATTCTGTACAACATAA
AACAGGAATATAAACGTATGCAGAAGAGGAGACATTTAGAAGCTAGTTTTCAGCAGACAGACCC
AGGTTGTAGTTCCGATTCACAGCCACATGCATTTCTCATCAGTGGACCAGCATCACCAGGGACT
TCATCTGCAACATCCTCACCATTAAAAAAAGAACAGCCCTTATTTACTCTAAGGCAGGTTGGGA
TGATCTGTGAACGTTTGTTGAAAGAACGGGAAGAGAAGGTTCGAGAAGAATATGAAGAAATACT
GAACACAAAACTTGCAGAACAATACGATGCATTTGTGAAGTTTACGCATGATCAGATAATGCGG
CGATATGGAGAACAGCCTGCTAGTTATGTTTCATGAATCACGCTTTTTGCATTTGTGGGCTGCC
TTGTCCCTTGTTGAGTTGTTGCAGGAGGTCCCAGCTGTGACATACAGCAATGCCAGCGCCCATC
TGTGAACCAGGTTATTTCAAGCTTTCGTCAGTGGCAACCACTCTTAGGCAGCAGCAATTGGTTT
TGGAAATTTCCGTGATGTCATTACCACCCGGATGTGGACCTTTGCTACTTGTATTAATACCAGT
GGCCTCGTTTTGCTGTATCATTACAATTTGGCTTCTTTATATTAATGTTTGAAAGGGATTAAAG
CTGGCATTTTAGAACATGCCCTTCACTGGTTATGTAAATAAAACTGTAGAATGACACGTCAGAT
GAAGTTAGTGTGATTTTAATTGTGCACTACAACCAAGCTGTAACCAGTTATTAATAACTTAGAA
TGTAATCCCAGGACATTTAAGCAGTTAGTCTACAGTACTTCAGTGAGATGGAGGAAGAGGAGGA
GGAGGGCATTTCTGTATTTCAGGACTTTTCTTGGGGTTTCAGAATGGGTTTATATGATTTCCTT
TATTATTTTTTGGTAGTTTTATTTATTCTATCAGTCTTTTTAACAAATGTTTATTGCTGCACCC
CTCCCCCAGTGTATTATTGTTTTACTGCCCTTGTAGCACTGGAGTTTAGTTGGAAAAATAAAAC
ATTTACTT

hide sequence

RefSeq Acc Id:

XM_063287300 ⟹ XP_063143370

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	53,897,792 - 53,918,873 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001035003	(Get FASTA)	NCBI Sequence Viewer
	XP_063143370	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAE81786	(Get FASTA)	NCBI Sequence Viewer
	EDL98593	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010962
	ENSRNOP00000010962.4
	ENSRNOP00055021961
	ENSRNOP00060006168
	ENSRNOP00065004973
GenBank Protein	Q25C79	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001035003 ⟸ NM_001039914

- UniProtKB:

Q25C79 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPASAAASPAAATAAAAASAAAASPQKYLRMEP
SPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLEASFQQTDPGCSSDSQPHAFLISGPASPGTSS
ATSSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRY
GEQPASYVS

hide sequence

RefSeq Acc Id:

ENSRNOP00000010962 ⟸ ENSRNOT00000010962

RefSeq Acc Id:	XP_063143370 ⟸ XM_063287300
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q25C79-F1-model_v2	AlphaFold	Q25C79	1-201	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693616

Promoter ID:

EPDNEW_R4141

Type:

initiation region

Name:

Akirin2_1

Description:

akirin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	50,002,285 - 50,002,345	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307791	AgrOrtholog
BioCyc Gene	G2FUF-41657	BioCyc
Ensembl Genes	ENSRNOG00000008288	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055016103	UniProtKB/Swiss-Prot
	ENSRNOG00060004914	UniProtKB/Swiss-Prot
	ENSRNOG00065004924	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010962	ENTREZGENE
	ENSRNOT00000010962.5	UniProtKB/Swiss-Prot
	ENSRNOT00055027325	UniProtKB/Swiss-Prot
	ENSRNOT00060008200	UniProtKB/Swiss-Prot
	ENSRNOT00065007171	UniProtKB/Swiss-Prot
InterPro	Akirin	UniProtKB/Swiss-Prot
KEGG Report	rno:297968	UniProtKB/Swiss-Prot
NCBI Gene	297968	ENTREZGENE
PANTHER	AKIRIN-2	UniProtKB/Swiss-Prot
	PTHR13293	UniProtKB/Swiss-Prot
PhenoGen	Akirin2	PhenoGen
RatGTEx	ENSRNOG00000008288	RatGTEx
	ENSRNOG00055016103	RatGTEx
	ENSRNOG00060004914	RatGTEx
	ENSRNOG00065004924	RatGTEx
UniProt	AKIR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Akirin2	akirin 2	RGD1307791	similar to hypothetical protein FLJ10342	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1307791	similar to hypothetical protein FLJ10342	RGD1307791_predicted	similar to hypothetical protein FLJ10342 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1307791_predicted	similar to hypothetical protein FLJ10342 (predicted)	LOC297968_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC297968_predicted	similar to hypothetical protein FLJ10342 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message