Advanced Search (OLGA)

Gene: Hpcal1 (hippocalcin-like 1) Rattus norvegicus

Analyze

Symbol:

Hpcal1

Name:

hippocalcin-like 1

RGD ID:

708375

Description:

Predicted to enable calcium ion binding activity. Predicted to be involved in regulation of signal transduction. Predicted to act upstream of or within liver development. Predicted to be located in membrane. Orthologous to human HPCAL1 (hippocalcin like 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hippocalcin-like protein 1; MGC105459; neural visinin-like Ca2+-binding protein type 3; neural visinin-like protein 3; NVL-3; NVP-3; Nvp3; VILIP-3; visinin-like protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HPCAL1 (hippocalcin like 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hpcal1 (hippocalcin-like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hpcal1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HPCAL1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HPCAL1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hpcal1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HPCAL1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HPCAL1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hpcal1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Hpcal1 (hippocalcin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HPCA (hippocalcin)	HGNC	OrthoDB
Homo sapiens (human):	VTA1 (vesicle trafficking 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	HPCAL1 (hippocalcin like 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hpcal1 (hippocalcin-like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hpcal1 (hippocalcin-like 1)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	FRQ1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	FRQ1	Alliance	DIOPT (Hieranoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Nca	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Nca	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hpcal1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	46,206,809 - 46,313,364 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	46,260,494 - 46,313,353 (+)	Ensembl				GRCr8
mRatBN7.2	6	40,478,206 - 40,584,721 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	40,478,208 - 40,584,687 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	40,806,736 - 40,912,925 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	41,121,436 - 41,227,619 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	40,554,695 - 40,660,883 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	43,001,920 - 43,109,083 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	43,001,948 - 43,109,071 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	52,713,426 - 52,818,872 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	41,458,062 - 41,576,771 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	39,777,051 - 39,883,137 (+)	NCBI		Celera
RGSC_v3.1	6	41,461,014 - 41,579,897 (+)	NCBI
Cytogenetic Map	6	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract 13 with adult i phenotype (ISO)

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (EXP,ISO)

amitrole (EXP)

ammonium chloride (EXP,ISO)

amosite asbestos (ISO)

Ampullosporin (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcium silicate (ISO)

capsaicin (EXP)

carbon nanotube (ISO)

cisplatin (ISO)

clofibrate (ISO)

clozapine (EXP)

cobalt dichloride (ISO)

cocaine (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

desloratadine (ISO)

diarsenic trioxide (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fluoxetine (EXP)

flusilazole (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (EXP)

gentamycin (EXP)

hypochlorous acid (ISO)

inulin (ISO)

ivermectin (ISO)

ketamine (EXP)

lead(0) (ISO)

maneb (ISO)

methapyrilene (ISO)

methimazole (EXP)

methoxychlor (EXP)

mitomycin C (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodimethylamine (EXP,ISO)

nickel sulfate (ISO)

ouabain (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

potassium dichromate (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

liver development (ISO)

regulation of signal transduction (IBA)

Cellular Component

membrane (IEA)

Molecular Function

calcium ion binding (IBA,IEA)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular cloning of two additional members of the neural visinin-like Ca(2+)-binding protein gene family.	Kajimoto Y, etal., J Neurochem 1993 Sep;61(3):1091-6.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Calcium-myristoyl switch, subcellular localization, and calcium-dependent translocation of the neuronal calcium sensor protein VILIP-3, and comparison with VILIP-1 in hippocampal neurons.	Spilker C and Braunewell KH, Mol Cell Neurosci 2003 Nov;24(3):766-78.
8.	Evidence for different functional properties of the neuronal calcium sensor proteins VILIP-1 and VILIP-3: from subcellular localization to cellular function.	Spilker C, etal., Biochim Biophys Acta 2002 Nov 4;1600(1-2):118-27.

Additional References at PubMed

PMID:11964161	PMID:12477932	PMID:15489334	PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Hpcal1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	46,206,809 - 46,313,364 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	46,260,494 - 46,313,353 (+)	Ensembl				GRCr8
mRatBN7.2	6	40,478,206 - 40,584,721 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	40,478,208 - 40,584,687 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	40,806,736 - 40,912,925 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	41,121,436 - 41,227,619 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	40,554,695 - 40,660,883 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	43,001,920 - 43,109,083 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	43,001,948 - 43,109,071 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	52,713,426 - 52,818,872 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	41,458,062 - 41,576,771 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	39,777,051 - 39,883,137 (+)	NCBI		Celera
RGSC_v3.1	6	41,461,014 - 41,579,897 (+)	NCBI
Cytogenetic Map	6	q16	NCBI

HPCAL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	10,302,904 - 10,427,604 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	10,301,356 - 10,427,835 (+)	Ensembl			hg38	GRCh38
GRCh37	2	10,443,030 - 10,567,730 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	10,360,491 - 10,485,194 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	10,394,423 - 10,518,340	NCBI
Celera	2	10,358,819 - 10,483,521 (+)	NCBI		Celera
Cytogenetic Map	2	p25.1	NCBI
HuRef	2	10,293,519 - 10,419,939 (+)	NCBI		HuRef
CHM1_1	2	10,372,357 - 10,497,099 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	10,330,643 - 10,457,210 (+)	NCBI		T2T-CHM13v2.0

Hpcal1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	17,740,810 - 17,841,943 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	17,740,857 - 17,841,934 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	17,690,750 - 17,791,944 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	17,690,856 - 17,791,933 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	17,697,620 - 17,798,732 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	17,716,294 - 17,817,406 (+)	NCBI		MGSCv36	mm8
Celera	12	18,013,124 - 18,114,964 (+)	NCBI		Celera
Cytogenetic Map	12	A1.2	NCBI
cM Map	12	8.13	NCBI

Hpcal1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955487	5,590,126 - 5,601,598 (+)	Ensembl
ChiLan1.0	NW_004955487	5,546,795 - 5,601,489 (+)	NCBI	ChiLan1.0	ChiLan1.0

HPCAL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	116,085,382 - 116,377,601 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	116,089,340 - 116,381,572 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	10,302,039 - 10,430,259 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	10,457,959 - 10,585,873 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	10,578,027 - 10,585,873 (+)	Ensembl			panPan2	panpan1.1

HPCAL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	7,246,032 - 7,359,821 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	7,245,776 - 7,359,172 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	7,173,332 - 7,285,510 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	7,345,257 - 7,457,756 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	7,345,272 - 7,457,753 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	7,236,279 - 7,348,259 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	7,238,577 - 7,350,841 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	7,252,795 - 7,364,956 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hpcal1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	51,727,877 - 51,818,719 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936532	6,568,889 - 6,574,958 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936532	6,482,794 - 6,573,769 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HPCAL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	126,107,412 - 126,220,309 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	126,107,407 - 126,220,381 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

HPCAL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	97,196,373 - 97,326,777 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	97,196,141 - 97,226,521 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	14,980,322 - 15,103,819 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hpcal1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624865	4,862,547 - 4,908,135 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624865	4,862,653 - 4,921,687 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hpcal1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	37,483,327 - 37,588,867 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hpcal1
832 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	59
Interacting mature miRNAs:	61
Transcripts:	ENSRNOT00000007374
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	44510974	89510974	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1975879	46975879	Rat
8693632	Alc27	Alcohol consumption QTL 27	2.2	0.791	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	40052411	56848866	Rat
634318	Bw118	Body weight QTL 118	3.55		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	6	39028659	63457441	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	40957564	85957564	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	45153786	90153786	Rat
8552910	Pigfal5	Plasma insulin-like growth factor 1 level QTL 5	4.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	22653889	67653889	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	31185002	76185002	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	3239989	48239989	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1975879	46975879	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1975879	46975879	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1975879	46975879	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	46047353	91047353	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1975879	46975879	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	3239989	48239989	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	86868070	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	3239989	48239989	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	33328841	78328841	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	30937632	75937632	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	33328841	78328841	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	39028659	86867923	Rat
70199	Coreg1	Compensatory renal growth QTL 1	11.8		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	6	14599473	63457687	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	16089372	61967788	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	3239989	48239989	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	40163183	85163183	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	22288257	67288257	Rat

Markers in Region

D6Rat138

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	40,543,933 - 40,544,194 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	43,069,502 - 43,069,762	NCBI	Rnor6.0
Rnor_5.0	6	52,779,364 - 52,779,624	UniSTS	Rnor5.0
RGSC_v3.4	6	41,524,975 - 41,525,346	RGD	RGSC3.4
RGSC_v3.4	6	41,525,066 - 41,525,326	UniSTS	RGSC3.4
Celera	6	39,842,438 - 39,842,698	UniSTS
RGSC_v3.1	6	41,528,101 - 41,528,472	RGD
RH 3.4 Map	6	203.5	RGD
RH 3.4 Map	6	203.5	UniSTS
RH 2.0 Map	6	361.6	RGD
SHRSP x BN Map	6	33.0298	RGD
Cytogenetic Map	6	q16	UniSTS

D6Got49

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	46,311,359 - 46,311,479 (+)	Marker Load Pipeline
mRatBN7.2	6	40,582,691 - 40,582,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	43,107,078 - 43,107,195	NCBI	Rnor6.0
Rnor_5.0	6	52,816,867 - 52,816,984	UniSTS	Rnor5.0
RGSC_v3.4	6	41,574,768 - 41,574,886	RGD	RGSC3.4
RGSC_v3.4	6	41,574,769 - 41,574,886	UniSTS	RGSC3.4
Celera	6	39,881,135 - 39,881,252	UniSTS
RGSC_v3.1	6	41,577,895 - 41,578,012	RGD
RH 3.4 Map	6	207.8	RGD
RH 3.4 Map	6	207.8	UniSTS
RH 2.0 Map	6	361.7	RGD
Cytogenetic Map	6	q16	UniSTS

RH129260

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	40,584,521 - 40,584,671 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	43,108,910 - 43,109,059	NCBI	Rnor6.0
Rnor_5.0	6	52,818,699 - 52,818,848	UniSTS	Rnor5.0
RGSC_v3.4	6	41,576,599 - 41,576,748	UniSTS	RGSC3.4
Celera	6	39,882,965 - 39,883,114	UniSTS
RH 3.4 Map	6	201.8	UniSTS
Cytogenetic Map	6	q16	UniSTS

AF085192

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	40,584,013 - 40,584,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	43,108,402 - 43,108,562	NCBI	Rnor6.0
Rnor_5.0	6	52,818,191 - 52,818,351	UniSTS	Rnor5.0
RGSC_v3.4	6	41,576,091 - 41,576,251	UniSTS	RGSC3.4
Celera	6	39,882,457 - 39,882,617	UniSTS
Cytogenetic Map	6	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001394052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001394053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_017356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007374 ⟹ ENSRNOP00000007374

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	46,260,494 - 46,313,353 (+)	Ensembl
mRatBN7.2 Ensembl	6	40,478,208 - 40,584,687 (+)	Ensembl
Rnor_6.0 Ensembl	6	43,001,948 - 43,109,071 (+)	Ensembl

RefSeq Acc Id:

NM_001394052 ⟹ NP_001380981

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,206,894 - 46,313,364 (+)	NCBI
mRatBN7.2	6	40,478,206 - 40,584,694 (+)	NCBI

RefSeq Acc Id:

NM_001394053 ⟹ NP_001380982

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,206,894 - 46,313,364 (+)	NCBI
mRatBN7.2	6	40,478,206 - 40,584,694 (+)	NCBI

RefSeq Acc Id:

NM_017356 ⟹ NP_059052

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,206,894 - 46,313,364 (+)	NCBI
mRatBN7.2	6	40,478,206 - 40,584,694 (+)	NCBI
Rnor_6.0	6	43,001,948 - 43,109,082 (+)	NCBI
Rnor_5.0	6	52,713,426 - 52,818,872 (+)	NCBI
RGSC_v3.4	6	41,458,062 - 41,576,771 (+)	RGD
Celera	6	39,777,051 - 39,883,137 (+)	RGD

Sequence:

show sequence

CGGGCTGGCGGCGGCTGCGGGTGGTGGACCTGCAGAGCGGCGGTCGCCTACACCTCGCTCTCTC
CTGGGCCGGCGGATCCTTTTGTCTCTCCAAGCGGTGAAGGTCGCAGAGTCGGCGCGGCGGTTGC
GGGCGCACTGACGCCCGTTCTATTGGTTATCTCCCCAGCCTCAGCCACCGCCGAACTTGAGCTC
GAGAAGCCAGCGGATCGCGTCCAGTTCCGGAGCCGGGGCATGGTCTAGCAGCTCAGTCAAGCCT
GTGCATCATCTGATCCCCAGCAGTTCTGGTCCCCCTTGGCCTCTACTTGGCTCTAGGTTTAGTC
TCCACTGCCAGCTGCCATGGGCAAGCAGAACAGCAAACTGCGGCCTGAGGTGCTGCAGGACCTG
CGGGAACACACAGAGTTCACTGACCATGAGCTGCAGGAGTGGTATAAGGGCTTCCTCAAGGACT
GTCCCACCGGCCACTTGACAGTGGACGAATTCAAGAAGATCTACGCCAACTTCTTCCCCTATGG
CGACGCCTCTAAGTTTGCCGAACACGTCTTCCGCACCTTTGACACCAACAGCGATGGCACCATC
GACTTCCGGGAGTTCATCATCGCACTGAGCGTGACCTCTCGGGGCAAGCTGGAGCAGAAGCTCA
AGTGGGCCTTCAGCATGTACGACCTGGACGGCAACGGCTACATCAGCCGCAGTGAAATGCTGGA
GATTGTGCAGGCCATCTACAAGATGGTGTCCTCCGTGATGAAGATGCCCGAGGATGAGTCCACA
CCCGAGAAGCGAACAGACAAGATCTTCAGGCAGATGGACACAAACAATGATGGCAAACTGTCCC
TGGAAGAATTCATCAAAGGTGCCAAGAGCGACCCGTCCATTGTCCGGTTGCTGCAGTGTGACCC
CAGCAGTGCTAGCCAGTTCTGAGGGGAACGGGCTTTTGGACAGTTGTGAGAAACACAGGCTTGA
CCTGCCATCTTCAGCTTTGCTTGCAAAAGTGGATTCCTCCGTGATCTCTCCTGCTCTCCCGGGA
CCTGGGCCAGGCAGCACATCACACCCACCCGACCTGCCCAGCCGCAACTCCCTCCTCTATCTGA
TCCGTCCGTTCGATATCCCTCCCCCTCCAGTCCAGGTTGGTTCCTTCCAAGGGTTCAAGTGTTC
TCGGCTGTAGGGCTCCTCCCTGCCCACAGAGGGCCCGGAGGCCCTTAAGGACACCAGACACGAC
TTTTCAGTATCCTACCGAGACCAGCTGATTCATTCTATGATCCCAGGTGACTTTGTGGGGATGA
AGAAGATGGAGAGTAGACAGGCAAGCCCTTCCTGTGCATGGCTCCACCTCCCTTGTTCATTTTC
TCTGACCAAAGCCGCTTGCACGTACATACCGTGGTCTCCTTACTTTTAATGTATGAGTTATGTG
TACGGTGAGATGGACTCTAACGTTTAGCCCCTGTATTTAATGCCTCTGACTGCCTTTGAAGCAT
GGTCCCCTGTGGCCTGTGACCCCACCCCATCCCCAAGTCTGGCTGTGCTGTGGTATTTATGCAT
TCGTGATTTGCCTGATTCCACAGGAGATACATGCATGCCCAGGGCTGCGGACATCTGCCCTCCG
TGCTGCAAATACAGGTGTTTCCGTGTGCTCCGTCCTCTTCTGTAAATTGGTCTGGCATATTAAA
ATGATCAAATAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

XM_039112773 ⟹ XP_038968701

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,244,803 - 46,313,361 (+)	NCBI
mRatBN7.2	6	40,515,769 - 40,584,721 (+)	NCBI

RefSeq Acc Id:

XM_063262353 ⟹ XP_063118423

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,206,809 - 46,313,361 (+)	NCBI

RefSeq Acc Id:

XM_063262354 ⟹ XP_063118424

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,279,580 - 46,313,361 (+)	NCBI

RefSeq Acc Id:

XM_063262355 ⟹ XP_063118425

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,206,809 - 46,313,361 (+)	NCBI

RefSeq Acc Id:

XM_063262356 ⟹ XP_063118426

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,209,437 - 46,313,361 (+)	NCBI

RefSeq Acc Id:

XM_063262357 ⟹ XP_063118427

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	46,209,412 - 46,313,361 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001380981	(Get FASTA)	NCBI Sequence Viewer
	NP_001380982	(Get FASTA)	NCBI Sequence Viewer
	NP_059052	(Get FASTA)	NCBI Sequence Viewer
	XP_038968701	(Get FASTA)	NCBI Sequence Viewer
	XP_063118423	(Get FASTA)	NCBI Sequence Viewer
	XP_063118424	(Get FASTA)	NCBI Sequence Viewer
	XP_063118425	(Get FASTA)	NCBI Sequence Viewer
	XP_063118426	(Get FASTA)	NCBI Sequence Viewer
	XP_063118427	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88759	(Get FASTA)	NCBI Sequence Viewer
	BAA02428	(Get FASTA)	NCBI Sequence Viewer
	EDM03157	(Get FASTA)	NCBI Sequence Viewer
	EDM03158	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007374
	ENSRNOP00000007374.3
GenBank Protein	P62749	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_059052 ⟸ NM_017356
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGKQNSKLRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKF AEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAI YKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSASQ F hide sequence

Ensembl Acc Id:

ENSRNOP00000007374 ⟸ ENSRNOT00000007374

RefSeq Acc Id:	XP_038968701 ⟸ XM_039112773
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001380982 ⟸ NM_001394053
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001380981 ⟸ NM_001394052
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118425 ⟸ XM_063262355
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118423 ⟸ XM_063262353
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118427 ⟸ XM_063262357
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118426 ⟸ XM_063262356
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118424 ⟸ XM_063262354
- Peptide Label:	isoform X1
- UniProtKB:	P62749 (UniProtKB/Swiss-Prot), A6HAV3 (UniProtKB/TrEMBL)

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62749-F1-model_v2	AlphaFold	P62749	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694514

Promoter ID:

EPDNEW_R5036

Type:

initiation region

Name:

Hpcal1_1

Description:

hippocalcin-like 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	43,001,937 - 43,001,997	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708375	AgrOrtholog
BioCyc Gene	G2FUF-38045	BioCyc
Ensembl Genes	ENSRNOG00000005492	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007374	ENTREZGENE
	ENSRNOT00000007374.7	UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7317905	IMAGE-MGC_LOAD
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
	Recoverin	UniProtKB/Swiss-Prot
KEGG Report	rno:50871	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105459	IMAGE-MGC_LOAD
NCBI Gene	50871	ENTREZGENE
PANTHER	HIPPOCALCIN-LIKE PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR23055	UniProtKB/Swiss-Prot
Pfam	EF-hand_7	UniProtKB/Swiss-Prot
PhenoGen	Hpcal1	PhenoGen
PRINTS	RECOVERIN	UniProtKB/Swiss-Prot
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005492	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
UniProt	A6HAV3	ENTREZGENE, UniProtKB/TrEMBL
	HPCL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	P35333	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Hpcal1	hippocalcin-like 1		neural visinin-like Ca2+-binding protein type 3	Name updated	1299863	APPROVED
2004-09-10	Hpcal1	neural visinin-like Ca2+-binding protein type 3	Nvp3		Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD