Advanced Search (OLGA)

Gene: Pex12 (peroxisomal biogenesis factor 12) Rattus norvegicus

Analyze

Symbol:

Pex12

Name:

peroxisomal biogenesis factor 12

RGD ID:

620757

Description:

Predicted to enable ubiquitin ligase activator activity; ubiquitin-protein transferase activity; and zinc ion binding activity. Involved in peroxisome organization. Located in peroxisome. Is active in peroxisomal membrane. Human ortholog(s) of this gene implicated in peroxisome biogenesis disorder 3A and peroxisome biogenesis disorder 3B. Orthologous to human PEX12 (peroxisomal biogenesis factor 12); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC100909787; PAF-3; peroxin-12; peroxisome assembly factor 3; peroxisome assembly protein 12; peroxisome assembly protein 12-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PEX12 (peroxisomal biogenesis factor 12)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pex12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pex12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PEX12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PEX12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pex12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PEX12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PEX12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pex12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pex12 (peroxisomal biogenesis factor 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PEX12 (peroxisomal biogenesis factor 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pex12 (peroxisomal biogenesis factor 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pex12 (peroxisomal biogenesis factor 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PEX12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	PEX12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pex12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pex12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	prx-12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pex12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pex12	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Candidate Gene For:

Bp302

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	68,593,307 - 68,596,938 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	68,593,308 - 68,596,938 (-)	Ensembl				GRCr8
mRatBN7.2	10	68,095,776 - 68,103,812 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,095,776 - 68,099,428 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	72,715,803 - 72,719,433 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,221,190 - 72,224,820 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	67,685,234 - 67,688,864 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	70,512,785 - 70,516,494 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	70,512,790 - 70,516,421 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	70,146,617 - 70,150,248 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	71,378,818 - 71,382,448 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	67,038,385 - 67,042,015 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

infantile Refsum disease (ISO)

peroxisomal biogenesis disorder (ISO)

peroxisome biogenesis disorder 1A (ISO)

peroxisome biogenesis disorder 3A (ISO)

peroxisome biogenesis disorder 3B (ISO)

Zellweger syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

choline (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

glafenine (EXP)

GSK-J4 (ISO)

indometacin (EXP)

iron dichloride (ISO)

isoprenaline (ISO)

L-methionine (ISO)

leflunomide (ISO)

methyl methanesulfonate (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

Soman (EXP)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to reactive oxygen species (ISO)

peroxisome organization (IEA,IMP,ISO)

protein import into peroxisome matrix (IBA,IEA,ISO)

protein import into peroxisome matrix, receptor recycling (ISO)

protein monoubiquitination (IBA)

protein polyubiquitination (ISO)

protein transport (IEA)

protein ubiquitination (IEA)

Cellular Component

peroxisomal importomer complex (IBA)

peroxisomal membrane (IBA,IDA,IEA,ISO)

peroxisome (IDA,ISO)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

ubiquitin ligase activator activity (ISO)

ubiquitin protein ligase activity (ISO)

ubiquitin-protein transferase activity (IBA)

zinc ion binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	PEX12 interacts with PEX5 and PEX10 and acts downstream of receptor docking in peroxisomal matrix protein import.	Chang CC, etal., J Cell Biol 1999 Nov 15;147(4):761-74.
2.	Isolation of the human PEX12 gene, mutated in group 3 of the peroxisome biogenesis disorders.	Chang CC, etal., Nat Genet 1997 Apr;15(4):385-8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	PEX12 encodes an integral membrane protein of peroxisomes.	Okumoto K and Fujiki Y, Nat Genet. 1997 Nov;17(3):265-6. doi: 10.1038/ng1197-265.
9.	PEX12, the pathogenic gene of group III Zellweger syndrome: cDNA cloning by functional complementation on a CHO cell mutant, patient analysis, and characterization of PEX12p.	Okumoto K, etal., Mol Cell Biol 1998 Jul;18(7):4324-36.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Characterization of the mammalian peroxisomal import machinery: Pex2p, Pex5p, Pex12p, and Pex14p are subunits of the same protein assembly.	Reguenga C, etal., J Biol Chem. 2001 Aug 10;276(32):29935-42. Epub 2001 Jun 7.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9922452	PMID:15489334	PMID:16813573	PMID:17534573	PMID:21525035

Genomics

Comparative Map Data

Pex12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	68,593,307 - 68,596,938 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	68,593,308 - 68,596,938 (-)	Ensembl				GRCr8
mRatBN7.2	10	68,095,776 - 68,103,812 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,095,776 - 68,099,428 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	72,715,803 - 72,719,433 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,221,190 - 72,224,820 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	67,685,234 - 67,688,864 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	70,512,785 - 70,516,494 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	70,512,790 - 70,516,421 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	70,146,617 - 70,150,248 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	71,378,818 - 71,382,448 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	67,038,385 - 67,042,015 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

PEX12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	35,574,795 - 35,578,571 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	35,574,795 - 35,578,863 (-)	Ensembl			hg38	GRCh38
GRCh37	17	33,901,814 - 33,905,590 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	30,925,928 - 30,929,687 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	30,925,927 - 30,929,687	NCBI
Celera	17	30,811,949 - 30,815,791 (-)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	30,086,798 - 30,090,636 (-)	NCBI		HuRef
CHM1_1	17	33,966,472 - 33,970,314 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	36,522,734 - 36,526,512 (-)	NCBI		T2T-CHM13v2.0

Pex12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	83,182,757 - 83,189,849 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	83,185,468 - 83,193,412 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	83,295,072 - 83,299,005 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	83,294,642 - 83,302,586 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	83,108,147 - 83,112,479 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	83,110,840 - 83,115,172 (-)	NCBI		MGSCv36	mm8
Celera	11	92,886,804 - 92,891,135 (-)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	50.3	NCBI

Pex12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	10,057,494 - 10,063,935 (-)	Ensembl
ChiLan1.0	NW_004955481	10,057,494 - 10,060,492 (-)	NCBI	ChiLan1.0	ChiLan1.0

PEX12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	28,898,300 - 28,902,961 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	30,777,263 - 30,781,925 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	21,216,181 - 21,221,107 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	21,510,296 - 21,514,310 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	21,510,286 - 21,514,310 (+)	Ensembl			panPan2	panpan1.1

PEX12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	38,083,895 - 38,088,192 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	38,084,285 - 38,087,011 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	37,308,233 - 37,312,231 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	38,895,855 - 38,899,853 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	38,895,826 - 38,899,846 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	37,679,858 - 37,683,856 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	37,964,168 - 37,968,166 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	38,051,615 - 38,055,613 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pex12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	37,069,927 - 37,073,042 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	1,527 - 5,069 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	1,751 - 5,094 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PEX12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	39,932,010 - 39,936,268 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	39,931,680 - 39,936,632 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	41,443,455 - 41,447,645 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PEX12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	29,049,206 - 29,054,718 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	922,468 - 926,100 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pex12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624875	3,082,505 - 3,085,540 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624875	3,081,581 - 3,085,441 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pex12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	87,384,582 - 87,388,236 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pex12
23 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	165
Count of miRNA genes:	104
Interacting mature miRNAs:	126
Transcripts:	ENSRNOT00000013233, ENSRNOT00000074774
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	67439473	73950209	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	67476608	73695498	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	67476608	73695498	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	64139597	83061459	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	12	61	133	57	60	41	86	41	298	168	11	124	71	73	19	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB002111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC118772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013233 ⟹ ENSRNOP00000013233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	68,593,308 - 68,596,938 (-)	Ensembl
mRatBN7.2 Ensembl	10	68,095,776 - 68,099,428 (-)	Ensembl

RefSeq Acc Id:

NM_053921 ⟹ NP_446373

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	68,593,308 - 68,596,938 (-)	NCBI
mRatBN7.2	10	68,095,777 - 68,099,407 (-)	NCBI
Rnor_6.0	10	70,512,791 - 70,516,421 (-)	NCBI
Rnor_5.0	10	70,146,617 - 70,150,248 (-)	NCBI
RGSC_v3.4	10	71,378,818 - 71,382,448 (-)	RGD
Celera	10	67,038,385 - 67,042,015 (-)	RGD

Sequence:

show sequence

GGAGCTTCTGTTTCCGGGTACGGTTTCTGTCACAAAGCCGAGCCCTCCTTTCGCAGGTGGCGTC
ACGGGTCCTCTGCTCCGTGCCCGAGGTCAGCAAGCAAGGACGGGCGCTTCCCAGCCAGCCACCG
GAGCCGGGCCTCGCAGCTCTGGGACTGCAGCTCGAGCGACACGTTCCTTGGCCCACACCTATCT
CCGAGTCACGCTCTGCCCTGTGAGGTGCCATGCAGAAGGACTAAGACTCAGCACCCGTTTGATA
CAAAACAAGTTCATGCTCCCTAGAGTGTTCGTGGGAAAAGTAAATCCCAGTACACACAAGACAC
TATGGCTGAGCATGGGGCTCATATCACAACTGCTTCGGTGGCGGACGACCAGCCATCCATCTTT
GAGGTGGTAGCACAGGACAGTTTAATGACAGCAGTGAGACCCGCTCTTCAGCATGTGGTCAAGG
TTCTTGCAGAATCAAATCCTGCGCACTATGGCTTCTTTTGGAGGTGGTTTGATGAAATCTTCAC
TCTGCTAGACTTTCTGCTCCAGCAGCATTATCTTTCTAGAACTAGTGCCTCATTTTCTGAACAC
TTTTATGGGTTAAAGCGGATTGTAGCGGGGAGCTCGCCGCAGCTTCAGAGACCAGCCAGTGCTG
GCCTCCCCAAGGAACACCTCTGGAAATCCGCTATGTTCCTTGTTCTTCTTCCCTATCTGAAAGT
GAAGCTGGAGAAGCTGGCTTCTACCTTGAGAGAAGAAGACGAATACTCTATTCACCCCCCTTCT
TCTCACTGGAAACGATTCTACAGAGTCTTCCTGGCTGCCTACCCGTTTGTTACCATGACCTGGG
AAGGCTGGTTCCTTACACAACAACTTCGGTACATATTGGGAAAAGCTGAGCATCACTCTCCCCT
GCTGAAACTGGCTGGAGTTCGGCTAGGTCGACTGACAGCTCAGGACATACAAGCTATGGAACAC
AGACTGGTTGAAGCCAGTGCAATGCAGGAGCCCGTCAGAAGCATTGGTAAGAAGATAAAGTCAG
CACTGAAGAAAGCTGTGGGAGGTGTTGCCTTATCCCTCTCTACTGGCCTCTCTGTGGGTGTATT
CTTCCTGCAGTTTCTTGACTGGTGGTACTCTTCTGAGAACCAAGAGACCATCAAGTCACTGACT
GCCCTGCCCACTCCACCACCACCTGTGCACCTCGACTACAACTCTGATTCTCCCCTCTTACCCA
AAATGAAAACAGTGTGCCCACTGTGTCGTAAAGCTCGGGTCAATGATACGGTTCTTGCCACCTC
TGGCTATGTATTCTGTTACCGCTGTGTGTTTAATTATGTGAGAAGTCACCAAGCCTGTCCCATT
ACAGGGTATCCAACGGAAGTCCAGCATCTAATTAAACTCTACTCTCCAGAGAACTGAAAGAGAG
ATTAGTGTATTCTCTCACAGCTCAAGTTCTATACTATAGGACCACAAGATGGTTTTAGTATGGC
AATCAACAATGATTCATAACTACATTAACTTTTAGTAGTTATATGGATTTCTTTAAAAGGATAT
ATCCACTTGGTCCTAACCTTATGGTTTGCTCTCTACCAAGCTGTTTAAGCAGGAGAATCAGGAT
TGTAGGTGGTGTGAGGGCCCATGTGGAGGTGGGTTATAAAAGACCACCTCACTTAAGAGTAAGG
TTTTAAGTTGTGGTAGTGTAGTGTCAGCACTCTGGAGATGGAGGCGGGAGTTTGAGTTCAAGGC
CACCAAAGGGGGAGTGTCAAAAGTAAAATGAAAGTAAGAGACTGATTAAGAGGGATAAAATAGC
ATAGGAAACCCCAGGTTAGATCTTACAAAGCAAGTGGTTTGGGAAGCAGGCCTTCTCTTTAGAA
AACATTTCTCTACTTTTGAAGTAGAGGCTTTATCAGACACGGACTTTCTCTTTATAGAAATATC
TATAAACCCTTTAGAGAAAAGCCCCCTCCATCTATCATGACTTACTAACATCTACCACAGTTTA
TCAGTATTTGAAGATTTCCTTCATGATCCATACCTGCCTGTCTAGGGAAGGGTTTGTTTATGGG
GCGGAGTCTGGAAATTTCAATATGAATAAAAACTAGCAATGGTGAGATGCAGTAAAATCTTTAT
CTAATGTTTACCTGATGCCTACCTAATAGATATCTAATGAGTAAAAGCTTTCTGCTTGCTCTTA
TGAGTTTGCTCAGTTGATAGGAATCATGCTAGGTATTATGAAAGTTTCTATGAAACATTTAATT
AAATTTTAACAATACATGATTCTAGGAAAGAATTGTTCCATGCTGTCATGATTATGTGGAAACT
CAAAAGATCACTTCAGGAGTTTAAATAAATTTTTATTCAGATC

hide sequence

RefSeq Acc Id:

XM_063268307 ⟹ XP_063124377

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	68,593,307 - 68,596,464 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446373	(Get FASTA)	NCBI Sequence Viewer
	XP_063124377	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH72481	(Get FASTA)	NCBI Sequence Viewer
	BAA31558	(Get FASTA)	NCBI Sequence Viewer
	EDM05474	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013233
	ENSRNOP00000013233.1
GenBank Protein	O88177	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446373 ⟸ NM_053921

- UniProtKB:

O88177 (UniProtKB/Swiss-Prot), A6HHG9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFDEIFT
LLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFLVLLPYLKV
KLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLRYILGKAEHHSPL
LKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAVGGVALSLSTGLSVGVF
FLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKARVNDTVLATS
GYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN

hide sequence

Ensembl Acc Id:

ENSRNOP00000013233 ⟸ ENSRNOT00000013233

RefSeq Acc Id:	XP_063124377 ⟸ XM_063268307
- Peptide Label:	isoform X1

Protein Domains

Pex N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88177-F1-model_v2	AlphaFold	O88177	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697527

Promoter ID:

EPDNEW_R8052

Type:

initiation region

Name:

LOC108348326_1

Description:

peroxisome assembly protein 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	70,516,433 - 70,516,493	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620757	AgrOrtholog
BioCyc Gene	G2FUF-23893	BioCyc
Ensembl Genes	ENSRNOG00000009718	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000013233	ENTREZGENE
	ENSRNOT00000013233.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7104469	IMAGE-MGC_LOAD
InterPro	PEX12	UniProtKB/Swiss-Prot
	Pex_N	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
KEGG Report	rno:116718	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91550	IMAGE-MGC_LOAD
NCBI Gene	116718	ENTREZGENE
PANTHER	PEROXISOME ASSEMBLY PROTEIN 12	UniProtKB/Swiss-Prot
	PTHR12888	UniProtKB/Swiss-Prot
Pfam	Pex2_Pex12	UniProtKB/Swiss-Prot
PhenoGen	Pex12	PhenoGen
PIRSF	Peroxisome_assembly_p12	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009718	RatGTEx
Superfamily-SCOP	RING/U-box	UniProtKB/Swiss-Prot
UniProt	A6HHG9	ENTREZGENE, UniProtKB/TrEMBL
	O88177	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-03-03	Pex12	peroxisomal biogenesis factor 12	LOC100909787	peroxisome assembly protein 12-like	Data merged from RGD:6501493	737654	APPROVED
2012-07-05	LOC100909787	peroxisome assembly protein 12-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-02-26	Pex12	peroxisomal biogenesis factor 12			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Pex12	peroxisomal biogenesis factor 12			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	human homolog is mutated in patients with the Zellweger syndrome complementation group III peroxisome deficiency	729522

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM